MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: neuromedin-K > substance K > substance P.
Gene References into Functions
Three Single-nucleotide polymorphisms (on chromosomes 3 and 11) were associated with vasomotor menopause symptoms in the African American group. However, 14 Single-nucleotide polymorphisms, all located on chromosome 4 in the tachykinin receptor 3 (TACR3) locus, had similar effect sizes across studies/participants' ancestry. Genetic variation in TACR3 may contribute to the risk of vasomotor menopause symptoms.PMID:28231077
observations of interspecies variation in the neurokinin 3 receptor brain localization with more extensive distribution in guinea pig than in primate brain; in the human brain, specific binding to the neurokinin 3 receptor was highest in the amygdala and in the hypothalamus and very low in other regions examinedPMID:26993630
High NK-3R expression is associated with Oral Squamous Cell Carcinoma.PMID:29061792
reduced to an almost undetectable level in polycystic ovary syndrome granulosa cellsPMID:27580802
Neuropeptide derivatives to regulate the reproductive axis: Kisspeptin receptor (KISS1R) ligands and neurokinin-3 receptor (NK3R) ligands.PMID:27271543
results suggest that peripheral sensory nerve-derived TAC3 may affect gingival oral squamous cell carcinoma cells through TACR3 in the bone matrixPMID:27919954
None of the 4 single polymorphisms studied in TACR3 are linked directly to puberty onset time, but A63P in TAC3 is statistically associated with precocious puberty.PMID:25153567
Elevated CRP is likely a pathogenic factor contributing to preeclampsia by binding to phosphocholinated neurokinin B and preferentially activating NK3R.PMID:25452470
data indicate that GPR54 and TACR3 gene mutations are not a frequent cause of ICPP. The identified A/G synonymous SNP (dbSNP ID: rs10407968) located in exon 1 of the gene is not likely to have a pathogenic role in exon splicingPMID:24434351
Studies indicate the molecular mechanisms by which NK3R mutations cause GnRH deficiency.PMID:24376026
Expression of the gene encoding TACR3 is significantly up-regulated in leiomyomas, compared with matched myometrium.PMID:23656837
the rs2765 SNP predicted the degree of impairment of learning and memory in 209 elderly patients with cognitive impairmentsPMID:23983264
Data suggest that mutations in TACR3 and GNRHR are the most common causative mutations in normosmic idiopathic hypogonadotropic hypogonadism in families in Turkey.PMID:22766261
report of a Japanese female with hypogonadism(IHH) and compound heterozygous TACR3 mutations and her heterozygous parents; results suggest hypothalamic dysfunction as primary cause for IHH in patients with biallelic TACR3 mutationsPMID:20395662
NK-3R plays a crucial role in hypothalamic gonadotropin releasing hormone release in humans.PMID:20194706
Results found no significant difference in the expression of tachykinins receptors between pre-eclamptic placenta and normal controls.PMID:16709596
Our results suggest that TACR3 is unlikely to be related to the development of schizophrenia in the Japanese population.PMID:18287949
small nucleotide polymorphisms in the 3' region of tachykinin receptor 3 gene (TACR3) provided significant evidence of association with alcohol dependencePMID:18422838
TAC3 and TACR3 mutations in familial hypogonadotropic hypogonadism reveal a key role for Neurokinin B in the central control of reproduction.PMID:19079066
Homozygosity for the TACR3 His148Leu mutation leads to failure of sexual maturation in humans, whereas signaling by the mutant receptor in vitro in response to either NKB or senktide is severely impaired.PMID:19755480