Recombinant Human Neuromedin-K receptor (TACR3)

Code: CSB-CF023070HU
Size:
20μg
20μg100μg
US$5974
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
TACR3
Uniprot NO.
Alternative Names
TACR3; NK3R; TAC3R; Neuromedin-K receptor; NKR; NK-3 receptor; NK-3R; Neurokinin B receptor; Tachykinin receptor 3
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-465
Target Protein Sequence
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: neuromedin-K > substance K > substance P.
Gene References into Functions
  1. Three Single-nucleotide polymorphisms (on chromosomes 3 and 11) were associated with vasomotor menopause symptoms in the African American group. However, 14 Single-nucleotide polymorphisms, all located on chromosome 4 in the tachykinin receptor 3 (TACR3) locus, had similar effect sizes across studies/participants' ancestry. Genetic variation in TACR3 may contribute to the risk of vasomotor menopause symptoms. PMID:28231077
  2. observations of interspecies variation in the neurokinin 3 receptor brain localization with more extensive distribution in guinea pig than in primate brain; in the human brain, specific binding to the neurokinin 3 receptor was highest in the amygdala and in the hypothalamus and very low in other regions examined PMID:26993630
  3. High NK-3R expression is associated with Oral Squamous Cell Carcinoma. PMID:29061792
  4. reduced to an almost undetectable level in polycystic ovary syndrome granulosa cells PMID:27580802
  5. Neuropeptide derivatives to regulate the reproductive axis: Kisspeptin receptor (KISS1R) ligands and neurokinin-3 receptor (NK3R) ligands. PMID:27271543
  6. results suggest that peripheral sensory nerve-derived TAC3 may affect gingival oral squamous cell carcinoma cells through TACR3 in the bone matrix PMID:27919954
  7. None of the 4 single polymorphisms studied in TACR3 are linked directly to puberty onset time, but A63P in TAC3 is statistically associated with precocious puberty. PMID:25153567
  8. Elevated CRP is likely a pathogenic factor contributing to preeclampsia by binding to phosphocholinated neurokinin B and preferentially activating NK3R. PMID:25452470
  9. data indicate that GPR54 and TACR3 gene mutations are not a frequent cause of ICPP. The identified A/G synonymous SNP (dbSNP ID: rs10407968) located in exon 1 of the gene is not likely to have a pathogenic role in exon splicing PMID:24434351
  10. Studies indicate the molecular mechanisms by which NK3R mutations cause GnRH deficiency. PMID:24376026
  11. Expression of the gene encoding TACR3 is significantly up-regulated in leiomyomas, compared with matched myometrium. PMID:23656837
  12. the rs2765 SNP predicted the degree of impairment of learning and memory in 209 elderly patients with cognitive impairments PMID:23983264
  13. Data suggest that mutations in TACR3 and GNRHR are the most common causative mutations in normosmic idiopathic hypogonadotropic hypogonadism in families in Turkey. PMID:22766261
  14. report of a Japanese female with hypogonadism(IHH) and compound heterozygous TACR3 mutations and her heterozygous parents; results suggest hypothalamic dysfunction as primary cause for IHH in patients with biallelic TACR3 mutations PMID:20395662
  15. NK-3R plays a crucial role in hypothalamic gonadotropin releasing hormone release in humans. PMID:20194706
  16. Results found no significant difference in the expression of tachykinins receptors between pre-eclamptic placenta and normal controls. PMID:16709596
  17. Our results suggest that TACR3 is unlikely to be related to the development of schizophrenia in the Japanese population. PMID:18287949
  18. small nucleotide polymorphisms in the 3' region of tachykinin receptor 3 gene (TACR3) provided significant evidence of association with alcohol dependence PMID:18422838
  19. TAC3 and TACR3 mutations in familial hypogonadotropic hypogonadism reveal a key role for Neurokinin B in the central control of reproduction. PMID:19079066
  20. Homozygosity for the TACR3 His148Leu mutation leads to failure of sexual maturation in humans, whereas signaling by the mutant receptor in vitro in response to either NKB or senktide is severely impaired. PMID:19755480

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 11528

UNIGENE: Hs.942

KEGG: hsa:6870

STRING: 9606.ENSP00000303325

OMIM: 162332

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products