LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.
Gene References into Functions
this paper shows that the decreased expression of activating receptor NKp30 on peripheral blood NK cells is positively associated with gastric cancer progressionPMID:30255106
Low NKp30 expression on NK cells is associated with Nasopharyngeal Carcinoma.PMID:29580037
we propose NKp30 status as a simple and early prognostic biomarker that identifies intermediate-risk patients with poor prognosis who otherwise may not be identified with existing risk stratification systems.PMID:28548938
Data indicate a sequence of events driven by tumour-derived prostaglandin D2 (PGD2) associated with engagement of the natural cytotoxicity triggering receptor 3 (NKp30)-B7H6 antigen (B7H6) pathway leading to significant group 2 innate lymphoid cells (ILC2s) activation and expansion.PMID:28928446
NKp44 and NKp30 splice variants profiles are tissue/condition specific and demonstrate similarity between placenta and cancerous tissues.PMID:27765926
Results found that rs2736191-C NCR3 carriers had a significant increased number of mild malaria episodes compared to the non-carriers. This SNP had a significantly increased promoter activity in NCR33 gene and involves a binding site for STAT4 and RUNX3.PMID:29121672
findings show HIV reservoir size is dependent on the presence of a defined NK cell population with a specific transcriptional signature: high NCR (NKp46 and NKp30) and IFN-gamma inducibility upon NCR and cytokine receptor engagementPMID:28956765
Copy number variations of HLA-I and activation of NKp30 pathway determine the sensitivity of gastric cancer cells to the cytotoxicity of natural killer cellsPMID:26364607
Data suggest that NK cells and NKp30 could play a role in Antisynthetase syndrome pathogenesis.PMID:27511738
the stalk domains of NKp30 and NKp46, another NCR employing CD3zeta for signaling, were not exchangeable without drastic deficiencies in folding, plasma membrane targeting, and/or ligand-induced receptor signaling.PMID:27754869
Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.PMID:25991472
NKp30-B7-H6 interaction is a novel cell contact mechanism that mediates activation of Group 2 innate lymphoid cells and identifies a potential target for the development of novel therapeutics for atopic dermatitis and other atopic diseases.PMID:26582946
Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failurePMID:26241657
the interaction between NKp30 and B7-H6 may contribute to the fate of neuroblastoma patientsPMID:25877893
Suggest role for NKp30 isoforms in influencing liver damage and ensuing fibrosis in chronic hepatitis C infection.PMID:26094914
show that in addition to NKG2D, human CEACAM1 can inhibit NK-cell activation via NKp30 or 2B4PMID:25824372
Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms.PMID:24882570
Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack.PMID:25315772
Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction.PMID:25001651
NKp30 was required for natural killer cell-fungal conjugate formation, phosphatidylinositol 3-kinase (PI3K) signaling, and perforin release.PMID:24139398
Data indicate that the ectodomain of NKp30 forms functional homo-oligomers that mediate high affinity binding to its corresponding cellular ligand B7-H6.PMID:24275655
we show for the first time that BAG-6(686-936) comprises a subdomain of BAG-6, which is sufficient for receptor docking and inhibition of NKp30-dependent NK cell cytotoxicity as part of a tumor immune escape mechanismPMID:24133212
Findings suggest that NK cells may promote an NKp30-dependent inflammatory state in salivary glands and that blockade of the B7H6/NKp30 axis could be clinically relevant in primary Sjogren's syndrome.PMID:23884468
HHIP, HDAC4, NCR3 and RARB polymorphisms may have a role in impaired lung function that begins in early lifePMID:23456936
These findings reveal that B7-H6 is not only implicated in tumor immunosurveillance but also participates in the inflammatory response in infectious conditions.PMID:23687088
Cytokine stimulation combined with natural killer cell receptor engagement are required for human natural killer cell functional diversity.PMID:23490421
data describe immune escape mechanism of monoclonal gammopathy/multiple myeloma occuring via downregulation of 3 major activating NK receptors (NCR3/NKp30, NKG2D and CD244/2B4/p38) in bone marrow, that was undetectable in peripheral blood.PMID:23360454
Using a codon-optimized gene fragment, we report remarkable yields for extracellular domain of human NK cell receptor (NKp30ex) when produced on M9 minimal medium, even with low (2g/L) glucose concentration.PMID:23059620
Natural cytotoxicity receptors play a major role in the recognition by NK cells of cancer stem cells targets.PMID:23345327
B7-H6:7D8 represents the first Ab-based molecule stimulating NKp30-mediated NK cell cytotoxicity for therapeutic purposesPMID:23066150
The stalk domain and the glycosylation status of the activating natural killer cell receptor NKp30 are important for ligand binding.PMID:22807449
NKp30 chimeric antigen receptor-expressing T cells produce interferon (IFN)-gamma and kill B7-H6 ligand-expressing tumor cells in vivo.PMID:22851709
NKp30 expression is significantly increased on the natural killer cells that persist at one week post-liver transplant in pediatric patients.PMID:22360401
NKp30 is a triggering receptor downstream of adhesion and plays an important role in NK cell activation, degranulation and cytotoxicity.PMID:22221078
a precise analysis of clinical data showed a correlation between decreased NCR expression and poor prognosis factors such as low haemoglobin level, high (>30x10(9) per litre) lymphocyte count or elevated C-reactive proteinPMID:22044312
alternatively spliced isoforms affect the prognosis of gastrointestinal stromal tumorsPMID:21552268
This study provides insights into NKp30 ligand recognition and a framework for a potential family of unidentified ligands.PMID:21444796
The NKp30-B7-H6 structure revealed that this NK cell activating complex is distinct from the CTLA4-B7 and PD-1-PD-L T cell inhibitory complexes in both overall organization and detailed atomic interactions that mediate binding and specificity.PMID:21422170
Observational study of gene-disease association. (HuGE Navigator)PMID:20712903
NKp30(high) cells are more effective in preventing infection of hepatitis C in high risk intravenous drug addicted individuals.PMID:20812318
Observational study of gene-disease association. (HuGE Navigator)PMID:19913121
Observational study of gene-disease association. (HuGE Navigator)PMID:20587610
Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)PMID:20628086
Observational study of gene-disease association. (HuGE Navigator)PMID:20663564
Selective cross-talk among natural cytotoxicity receptors (NKp46, NKp30 and NKp44) in human natural killer cells.PMID:12731048
CD59 is physically associated with NKp46 and NKp30 and activate human nk cell-mediated cytotoxicity.PMID:14635045
NKG2D, NKp30, NKp44, and NKp46 acitvation affected by ligand-negative phenotype in bone marrow-derived progenitor cells, acquisition of cell-surface ligands during myeloid differentiation, defective expression of ligands on malignant transformationPMID:15657183
NKp30 is not only a triggering molecule essential for antitumor activity but is also a surface receptor involved in natural killer cell suicide.PMID:15728472
NK cell-mediated induction of dendritic cell maturation is dependent on NKp30.PMID:15784725
heparan sulfate glycosaminoglycans are not ligands for NKp30, leaving open the question as to the nature of the cellular ligand for this important NK cell activation receptorPMID:15972650
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Natural cytotoxicity receptor (NCR) family
Tissue Specificity
Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.