QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Gene References into Functions
this paper shows that the decreased expression of activating receptor NKp46 on peripheral blood NK cells is positively associated with gastric cancer progressionPMID:30255106
HIF-1alpha inhibits NCR1/NKp46 pathway through up-regulating miR-224, which affects the killing capability of NK cells on prostate cancer, thus inducing immune escape of tumor cells.PMID:29885835
The authors demonstrated that mutant NKp46 W32R is aberrantly glycosylated, accumulates in the endoplasmic reticulum, and is unstable on the cell surface.PMID:28134248
Low NKp46 expression on on NK cells is associated with Nasopharyngeal Carcinoma.PMID:29580037
Signaling via the natural killer cell receptor NKp46 (human) and Ncr1 (mouse) induced interferon-gamma (IFN-gamma) secretion from intratumoral natural killer cells.PMID:29329948
findings show HIV reservoir size is dependent on the presence of a defined NK cell population with a specific transcriptional signature: high NCR (NKp46 and NKp30) and IFN-gamma inducibility upon NCR and cytokine receptor engagementPMID:28956765
NKp46 cleavage by Cathepsin G severely impairs NKp46-mediated responses of Natural killer cells.PMID:27587403
The NKp46 and NKp46-ligand interaction contributes to NK cell activation.PMID:28328926
this study shows that the NKp46-activating receptor recognizes an unknown ligand expressed by human metapneumovirus-infected cellsPMID:28191644
Intrahepatic NKp46 NK cells exhibited anti-HCV activity via cell-to-cell contact. The variation of the NKp46 proportion in individuals could be attributed to the diversity of HCV resistance observed in these individuals.PMID:26714120
Taken together, these results demonstrate that endogenous levels of IFN-alpha secreted by plasmacytoid dendritic cells induce natural killer cells to lyse HIV-1-infected autologous CD4+ primary T cells via the engagement of NKp46 and NKG2D.PMID:26372382
NKp46 was thus involved in the production of serine proteases and interleukin-22 in human mast cells.PMID:25940096
Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.PMID:25991472
Ncr1-Noe proteins accumulate in the endoplasmic reticulum, and that the expression of Ncr1-Noe proteins, but not WT Ncr1, leads to increased Helios expressionPMID:26371250
Data show that regulatory dendritic cells (regDC) restrain IFN-gamma secretion by NK cells through secretion of interleukin-10 (IL-10), engagement of MHC class I-specific inhibitory receptors, and the activating receptor NKp46.PMID:26232426
Expression of NKp46/NCR1 in NK cells was significantly higher in untreated severe aplastic anemia patients than those in remission SAA and controls. This may be the reason for the hyperfunction of the immune system in SAA patients.PMID:26554241
Downregulated NKG2D, NKp46, and DNAM-1 receptors associated with impaired NK cell effector function are important biomarkers of advanced disease with a poor prognosis in melanoma patients.PMID:24769842
Women, w/ or w/o endometriosis, having larger populations of cytotoxic CD16(+) uterine NK cells and/or higher populations of NKp46(+)CD56(+) cells may be at greater risk of infertility resulting from inflammatory environment during implantation or laterPMID:24807109
IL-15+IL-12 has an immunomodulatory effect on NK cell subsets from HIV-infected individuals viz down-regulation of iNKRs, elevation of activatory receptors NKp46 and NKG2D, and induction of coreceptor NKp80.PMID:22715368
NKp46 marks out pathologically activated natural killer cells, which may result from a loss of homeostatic control of activating receptor expression in hepatitis C virus.PMID:23665989
NKp46 is expressed on CD4 lymphocytes in mycosis fungoides and Sezary syndrome.PMID:23900021
Cytokine stimulation combined with natural killer cell receptor engagement are required for human natural killer cell functional diversity.PMID:23490421
involved in cytokine production of CD56+ NK cells in the uterine endometriumPMID:23311919
PLS3, Twist, KIR3DL2 and NKp46 gene expression can model efficient molecular Sezary syndrome diagnosis.PMID:23429988
NKp46 expression of hepatitis C virus replication controls the modulation of liver fibrosis.PMID:22532190
Race and gender related variation found in NKp46 receptor expression with differential anti-hepatitis C virus immunity.PMID:22505144
expressed in all investigated cases of transformed mycosis fungoidesPMID:22621189
We suggest that NKp46 dimerization contributes to NKp46-mediated lysis by NK cells.PMID:22615207
NKp46 levels remain stable on the natural killer cells that persist at one week post-liver transplant in pediatric patients.PMID:22360401
important role in inhibition of liver fibrosisPMID:22198715
This study demonistrated that NCR1 expression on astrocytes in MS tissue.PMID:22212381
Role of runt-related transcription factor 3 (RUNX3) in transcription regulation of natural cytotoxicity receptor 1 (NCR1/NKp46), an activating natural killer (NK) cell receptor.PMID:22253448
findings show that NK cells can significantly accelerate neutrophil apoptosis, and that this process is dependent on cell-cell contact and mediated by the activating NK cell receptor NKp46 and the Fas pathwayPMID:22231698
decreased expression is associated with altered NK-cell function in pediatric transplant patients with PTLDPMID:22105417
we investigate whether NKp46 is involved in the killing of human beta cellsPMID:21849674
NKp46 identifies a functionally distinct NKT subset in that appears to be directly susceptible to leukemic transformation when IL-15 is overexpressed.PMID:21364281
Data show that an increase in 2B4-expressing NK cells and a decrease in NKp46(+) NK cells occurred following intramuscular influenza vaccination.PMID:21214542
peripheral blood malignant CD4(+) T lymphocytes from patients with Sezary syndrome, an aggressive form of cutaneous T-cell lymphoma, express NKp46 at their cell surfacePMID:21191411
NKp46 interacts with heparin and heparan sulfate, highly sulfated glycans, and multimeric alpha2,3-NeuAc-containing N-glycan; these glycans interact mainly with basic amino acids in NKp46.PMID:21329668
Data show that only NKp46 appeared involved in the NK response.PMID:21030563
NKp46 is essential for the development of type 1 diabetesPMID:20023661
The NKp46 receptor participates in NK cell-mediated lysis of cells infected with the intracellular pathogen Mycobacterium tuberculosis, an activity that is reduced in tuberculosis patients compared with findings in healthy donors.PMID:11907104
crystal structure of the human natural killer (NK) cell activating receptor NKp46PMID:12960161
NKp46 interacts with both viral hemagglutinins and the unknown tumor ligands via different mechanisms.PMID:14504081
CD59 is physically associated with NKp46 and NKp30 and activate human nk cell-mediated cytotoxicity.PMID:14635045
natural cytotoxicity receptor (NCR) and NK receptor member D of the lectin-like receptor family (NKG2D) were the key NK activating receptors for bone marrow-derived myeloma cell recognitionPMID:15328155
NKp46 is not only a triggering molecule essential for antitumor activity but is also a surface receptor involved in natural killer cell suicide.PMID:15728472
Results examine residues in NKp46 that may be involved in heparan sulfate binding on tumor cells.PMID:16262248
defect in cytotoxic effector function is associated with a reduced surface expression of activating NK receptors (NKp30, NKp46, and NKG2D) on CD56(dim) NK cells compared with uninfected newborns.PMID:16690951
The natural cytotoxicity receptor NKp46 was required for the killing of all myeloma cell lines analyzed.PMID:17875681
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Natural cytotoxicity receptor (NCR) family
Tissue Specificity
Selectively expressed by both resting and activated NK cells.