MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
66.2 kDa
Protein Length
Full Length
Tag Info
C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃.
Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
NOH-1S is a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes and other tissues. It participates in the regulation of cellular pH and is blocked by zinc. NOH-1L is a pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism, whereas NOH-1S does not contain an electron transport chain.
Gene References into Functions
this study shows that NOX1 loss-of-function genetic variants in patients with inflammatory bowel diseasePMID:29091079
depletion of NOX1 and NOX4 partially rescued the growth inhibition of PARP1-deficient tumor xenografts. Our findings suggest that in addition to compromising the repair of DNA damage, PARP inhibition or depletion may exert extra antitumor effect by elevating oxidative stress in ovarian cancer cellsPMID:29684820
NOX activation might have a role in regulation of lymphocytic activity in patients with idiopathic nephrotic syndrome through the impairment of PDGF mitogenic function and might contribute toward pathogenesis of nephrotic syndrome.PMID:28613279
The SUMO1/UBC9 axis may regulate Nox1mediated diabetic retinopathy by inhibiting reactive oxygen species generation and apoptosis.PMID:29138839
Results show that the thrombospondin 1 (TSP1) and its receptor CD47 (CD47) axis selectively regulates NADPH oxidase 1 (Nox1) in the regulation of endothelial senescence and suggest potential targets for controlling the aging process at the molecular level.PMID:29042481
in CAD, both mitochondria and NADPH oxidase contribute to flow-induced vasodilation through a redox mechanism in visceral arterioles.PMID:28480622
NADPH oxidase-mediated redox signaling is important in the detrimental effect of C-reactive protein on pancreatic insulin secretion.PMID:28778482
S340E mutation enhances Nox1 activation (Kaito et al., 2014), the present study suggests that betaPix can also play an inhibitory role in O2(-) production, depending on the sites of phosphorylation.PMID:29242061
the anti-proliferative and pro-apoptotic effect of cambogin on breast adenocarcinoma is mediated via inducing NOX1-dependent ROS production and the dissociation of ASK1 and Trx1PMID:27418140
Transcriptional regulation of NOX genes expression in human breast adenocarcinoma cells is modulated by adaptor protein CIN85.PMID:29227594
the transition-state substrate analogue inhibitor of Prdx6 phospholipase A2 activity (MJ-33) was shown to suppress Nox1 activity, suggesting Nox1 activity is regulated by the phospholipase activity of Prdx6. Finally, wild type Prdx6, but not lipase or peroxidase mutant forms, supports Nox1-mediated cell migration in the HCT-116 colon epithelial cell model of wound closurePMID:27094494
Cells redox environment mediated by NOX1 isozymes activation down-regulates BRCA1 expression and promotes DNA homologous recombination repair in cancer.PMID:27771433
LRRC8A channels support TNFalpha-induced superoxide production by Nox1 which is required for receptor endocytosis.PMID:27838438
These results are consistent with the hypothesis that antioxidants or NOX1/4 inhibition may be useful in blocking profibrotic effects of TGFbeta on dermal and gingival fibroblasts and warrant consideration for further development as potential antifibrotic agentsPMID:29049376
We demonstrated that rapid deletion of p22phox is possible and that the activity of Nox1 and Nox4 but not Nox5 exclusively depends on p22phox.PMID:27614387
5-HT1B receptor-dependent cellular Src-related kinase-Nox1-pathways contribute to vascular remodeling in pulmonary arterial hypertension.PMID:28473438
NOX1 has a role in maintaining the proliferative phenotype of some colon cancers and has potential as a therapeutic target in this diseasePMID:28330872
NOX1 mRNA was undetectable in the gastric mucosa.PMID:27048452
P38 MAPK, phosphorylated P38 MAPK, and RAC2 regulated in mutual feedback and negative feedback regulatory pathways, resulting in the radioresistance of G0 cells.PMID:27936335
NS5A contributes to reactive oxygen species production by activating expression of NADPH oxidases 1 and 4 as well as cytochrome P450 2E1.PMID:27200149
our results highlight that the Nox1/AKT signaling pathway plays an important role in cell survival in oral squamous cell carcinoma (OSCC) cells.PMID:27600098
p38 and NOX1 are essential for the protective effect of c-Myb and that NOX1 acts upstream of p38 activation.PMID:27107996
The results suggested that radiationinduced pulmonary fibrosis may be efficiently reduced by specific inhibition of NOX1, an effect mediated by reduction of fibrotic changes of ECs.PMID:27053172
Overexpression of NADPH oxidase 1 is associated with increased migration/metastasis rate in melanoma.PMID:26760964
The results of this study demonstrate that OA itself is not a cause to increase arNOX activities.PMID:26339163
These results indicate that physiological levels of ROS produced by the NOX complex modulate hippocampal neuronal polarity and axonal growth in vitro.PMID:26101350
High glucose generated an increase in NADPH oxidase activity and expression in human vascular smooth muscle cells. Sequence analysis of human Nox1, Nox4, and Nox5 gene promoters was performed.PMID:25722086
NOX1 and NOX4 signaling mediates the pathogenesis of liver fibrosis, including the direct activation of HSC.PMID:26222337
Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK.PMID:26116564
Increased NOX1 expression in gallbladder cancer cells promoted the chemoresistance of the cells through elevating intracellular reactive oxygen species level and HIF1a expression as well as increasing MDR1 expression.PMID:26545779
NLRP3 inflammasome activation and generation of pulmonary fibrosis is affected by NADPH oxidase by multi-walled carbon nanotubesPMID:25581126
NADPH oxidase 1 was responsible for superoxide generation and cell proliferation in low-density lipoprotein-stimulated aortic smooth muscle cells.PMID:26065917
High NADPH oxidase expression is associated with chronic myelogenous leukemia.PMID:24833663
Data show that lipopolysaccharide induced vascular endothelial cell migration is mediated by toll-like receptor TLR-4/NF-kappa B pathway and enzyme NAD(P)H oxidase in association with the transient receptor potential melastatin 7 (TRPM7) ion channel.PMID:25130439
Studies indicate the role of 70 kDa heat-shock protein (HSP70) in the activation of NADPH oxidase isoforms and in islet alpha- and beta-cell physiological function in health and Type 2 diabetes mellitus.PMID:25881670
Data (including data from transgenic/knockout mice) suggest that inhibition of NOX1 and NOX2/CYBB (but not NOX4) in vascular endothelium conforms to current models for treatment of vascular diseases. [REVIEW]PMID:25066192
Nox1 post-translationally regulatedCK18 stability in a ROS-, phosphorylation- and PKCepsilon-dependent manner. It accelerates neoplastic progression by regulating structural intermediate filaments leading to epithelial mesenchymal transition.PMID:24494188
Elevated ROS derived from NOX1 activation and downregulation of SOD in NIH3T3RET-MEN2A and NIH3T3RET-MEN 2B cells may be involved in RET constitutive tyrosine auto-phosphorylationPMID:24437351
NOX1 is involved in acure respiratory distress syndrome pathophysiology and is responsible for the damage occurring in alveolar epithelial cells at least in part via STAT3 signalling pathways.PMID:24551274
NOX1 inhibition not only prevented iNOS induction but also abrogated changes consequent to iNOS induction such as mesangial fibrogenesis.PMID:23801050
BetaPix phosphorylation at Ser-340 upregulates Nox1 through Rac activation.PMID:24792722
Data from studies with Caco-2 cells (an in vitro model of inflammatory bowel disease) suggest a dietary component (antioxidant/pigment indicaxanthin in fruit of cactus pear) can prevent activation of NOX1/NFkB (nuclear factor kappa B) in enterocytes.PMID:23931157
p22(phox) directly contributes to Nox1 activation in a glycosylation-independent manner, besides its significant role in Nox1 glycan maturation.PMID:24365146
It is a superoxide producing enzyme.(review)PMID:24334927
Physical frailty in older people is associated with superoxide anion overproduction by NADPH oxidase and low-grade chronic inflammation.PMID:22640231
The activity of NADPH oxidase (NOX), a major superoxide-generating enzyme system, in peripheral blood lymphocytes (PBL) from galactosemia patients, was examined.PMID:23828587
Expression of NOX-1 in beta cells is regulated in a feed-forward loop mediated by reactive oxygen species and Src-kinase.PMID:23410839
results provide evidence plasma from preeclampsia generates superoxide via a LOX1-NOX2-mediated pathway and downregulates endothelial KCa3.1, which may contribute to endothelial dysfunction and vasculopathy in preeclampsiaPMID:23261940
Nox1 levels were higher in the primary SW480 cells than that in metastatic SW620 cells.PMID:23627409
NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.