METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophil chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4). Receptor for the chemokine-like protein FAM19A5, mediating FAM19A5-stimulated macrophage chemotaxis and the inhibitory effect on TNFSF11/RANKL-induced osteoclast differentiation. Acts as a receptor for humanin.
Gene References into Functions
FPR2 promotes invasion and metastasis of gastric cancer cells and predicts the prognosis of patients.PMID:28600569
Phenol-soluble modulin (PSM) peptides from highly pathogenic Staphylococcus aureus are efficient ligands for FPR2.PMID:28855276
these results show that FPR2signaling interferes with the endosomal trafficking of influenza viruses and provides, for the first time, the proof of concept that monoclonal antibodies directed against FPR2 inhibit virus replicationPMID:29738458
serum amyloid A (SAA) may stimulate the migration of SKOV3 cells through FPR2. The present study suggested that FPR2 promoted the invasion and metastasis of Epithelial ovarian cancer (EOC) and it could be a prognostic marker for EOC.PMID:29039544
plasma levels higher in preeclamptic women than in nonpregnant and normotensive pregnant women, and similar between nonpregnant and normotensive pregnant womenPMID:27179254
Our findings provide evidence for defective LXA4 generation and FPR2/ALXR expression that, associated with increased LTB4, might be involved in a reduction in the ability of inhaled corticosteroids to impair control of airway inflammation in children with SA.PMID:26971688
These data show that viral replication and IAV pathogenesis depend on FPR2 signaling and suggest that FPR2 may be a promising novel strategy to treat influenza.PMID:27034344
Changes in the histone acetylation/methylation status enhanced FPR2 signaling in response to LXA4 during inflammation process.PMID:27424221
a novel FPR2 agonist, the proteolytically stable alpha-peptide/beta-peptoid hybrid Lau-((S)-Aoc)-(Lys-betaNphe)6-NH2 (F2M2), showing comparable potency in activating human and mouse neutrophils by inducing a rise in intracellular Ca(2+) concentration and assembly of the superoxide-generating NADPH oxidase.PMID:27422818
We conclude that ANX-A1 is an important regulator of mast cell reactivity to compound 48/80 exerting a negative feedback effect through a mechanism that depends at least partly on the FPR receptorPMID:26803520
pro-inflammatory stimuli lead to FPR2/ALX expression while LXA4 induces an anti-inflammatory responsePMID:26248046
Data show that the purinergic receptor P2Y2 (P2Y2R) pepducin activates neutrophils through formyl peptide receptor 2 (FPR2), and ATP is turned into an activating agonist through a receptor cross-talk mechanism that involves both FPR2 and P2Y2R.PMID:26996596
Lipoxin A4 may have a role in preventing metabolic syndrome in a middle-aged Chinese populationPMID:26565966
Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.PMID:26297794
significant increase in expression of mRNA in placenta from women with pre-eclampsiaPMID:24960456
ANXA1 may contribute to the regulation of tumor growth and metastasis through paracrine mechanisms that are mediated by FPR2/ALXPMID:25490767
Role of formyl peptide receptor 2 in homing of endothelial progenitor cells and therapeutic angiogenesisPMID:25304660
Expression of FPR2/ALX was analysed in 127 carotid atherosclerotic lesions and revealed that this receptor was expressed on macrophages, smooth muscle cells, and endothelial cells.PMID:25341894
There was an excessive maternal inflammatory response in preeclampsia. LXA4, ALX-R, and NF-kappaB p65 may be involved in the disease process ofpreeclampsia.PMID:25864260
Molecular determinants required for modulation of endocytic recycling in the anti-apoptotic function of FPR2/ALX.PMID:25326384
A stable peptidomimetic inhibited the activation of human neutrophils via direct interaction with FPR2.PMID:25462815
The effects of diclofenac on the incidence of pancreatitis following endoscopic retrograde cholangiopancreatography via lipoxin A4 and resolvin D1 and E1 levels is reported.PMID:25030943
Uteroglobin is a possible ligand of the lipoxin receptor and it may have a role in inhibiting serum amyloid A-driven inflammationPMID:24782597
The MAT-1 can induce chemotaxis specifically using FPR2, a receptor found on the surface of monocytes, macrophages and neutrophils.PMID:24617769
We also found that human mast cells expressed the N-formyl-peptide receptor 1 (FPRL1) receptor and FPRL1-specific inhibitor affected pleurocidin-mediated activation of mast cell.PMID:23839065
LXA decreased IgM and IgG production on activated human B cells through ALX/FPR2-dependent signaling.PMID:24166736
Structural determinants for the interaction of formyl peptide receptor 2 with peptide ligands.PMID:24285541
The H. pylori-derived peptide Hp(2-20) stimulated eosinophil migration through the engagement of FPR2 and FPR3, and also induced production of VEGF-A and TGF-beta, two key mediators of tissue remodelling.PMID:24067461
FPR2 is expressed in minor salivary glands with and without Sjogren's syndrome.PMID:24259417
lipoxin A4 may play a role in the resolution of upper airway inflammation. A low concentration of lipoxin A4 may be involved in chronic inflammation of the upper airways.PMID:24358628
Ligand-specific conformational change of the G-protein-coupled receptor ALX/FPR2 determines proresolving functional responses.PMID:24108355
FPR2 is not activated by lipoxin (LX)A; the molecular mechanism by which LXA functions still needs to be identified.PMID:23643932
Cross-talk between FPR2 and HGF receptor in human prostate epithelial cells.PMID:23583448
FPR2 is upregulated in peripheral blood mononuclear cells from patients with atherosclerosis.PMID:23500463
FPRL1 is responsible for TLR3 signaling induced by LL-37-poly(I:C).PMID:23386607
It was concluded that the ability of FPR2 to discriminate between the enantiomers is the consequence of the arrangement of three asymmetric hydrophobic subpockets at the main orthosteric FPR2 binding site.PMID:23219934
Most of the analyzed Enterococcus faecium but only sporadic Enterococcus faecalis strains released FPR2/ALX-stimulating molecules leading to neutrophil calcium ion fluxes, chemotaxis, and complement receptor upregulation.PMID:22768166
No evidence for the involvement of the lipoxin A4 receptor (FPR2/ALX ) gene in the susceptibility to coronary artery diseasePMID:22734147
N-terminal region was dispensable for AnxA1-induced FPR2/ALX down-regulation in both the homologous and heterologous desensitization modes.PMID:22610094
Neutrophil activity induced by a cell-permeable peptide derived from the third intracellular loop of FPR2 is dose-dependently inhibited by membrane-permeable peptide inhibitor PBP10.PMID:22706076
Single-nucleotide polymorphism located in the intron of FPR2 is related to aspirin hypersensitivity in asthmatics.PMID:22377711
Results provide information on FPR2/ALX transcriptional regulation and evidence of mutations that affect FPR2/ALX transcription.PMID:22131270
These data support a model in which FPR2/ALX plays a role in chemotaxis and activation of monocytes; however, they also suggest that its function in resident tissue macrophages is limited.PMID:22246625
FPR2 has an appreciable pleiotropic regulator role in tumor immunoeditingPMID:21499310
SAA up-regulates PTX3 production via FPRL1 significantly, and thus, contributes to the inflammatory pathogenesis of atherosclerosis.PMID:21465531
N-formyl peptide receptor 3 (FPR3) departs from the homologous FPR2/ALX receptor with regard to the major processes governing chemoattractant receptor regulation, expression at the cell surface, and phosphorylation.PMID:21543323
Data sugget the existence of an endogenous network in anti-inflammation centered on PMN AnxA1 and activated by selective FPR2/ALX agonists.PMID:21398608
the innate immune system may be able to respond in different ways to pathogenic or innocuous staphylococci by monitoring the presence of phenol-soluble modulins via FPR2.PMID:21183593
Data suggest that bacteria induce glial cell activation and rCRAMP expression via FPRL1 and MARCO, and these receptors contribute to the host defence against infection.PMID:21299846
The results indicate that SAA stimulates FPR2-mediated activation of p38 MAPK and JNK, which are independent of a pertussis toxin-sensitive G-protein and are essential for SAA-induced CCL2 production.PMID:20177146
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in lung, bone marrow, neutrophils, spleen and testis.