Home
Product
Protein
Transmembrane Proteins
Recombinant Human N-arachidonyl glycine receptor (GPR18)

Recombinant Human N-arachidonyl glycine receptor (GPR18)

Code: CSB-CF614525HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4971

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GPR18

Uniprot NO.

Q14330

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-331

Target Protein Sequence

MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIY MMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRY MAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIY LKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQ VLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISV MLYRNYLRSMRRKSFRSGSLRSLSNINSEML
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for endocannabinoid N-arachidonyl glycine (NAGly). However, conflicting results about the role of NAGly as an agonist are reported. Can also be activated by plant-derived and synthetic cannabinoid agonists. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. May contribute to regulation of the immune system. Is required for normal homeostasis of CD8+ subsets of intraepithelial lymphocytes (IELs) (CD8alphaalpha and CD8alphabeta IELs)in small intstine by supporting preferential migration of CD8alphaalpha T-cells to intraepithelial compartment over lamina propria compartment, and by mediating their reconstitution into small intestine after bone marrow transplant. Plays a role in hypotensive responses, mediating reduction in intraocular and blood pressure. Mediates NAGly-induced process of reorganization of actin filaments and induction of acrosomal exocytosis.

Gene References into Functions

Results indicate that G protein-coupled receptor 18 (GPR18) might be involved in physiological processes of spermatozoa, suggesting GPR18 to be a potential player in sperm physiology. PMID:27572937
A novel RvD2-GPR18 resolution axis stimulates human and mouse phagocyte functions to control bacterial infections and promote organ protection. PMID:26195725
the results presented herein provide further evidence for GPR18 as a candidate cannabinoid receptor PMID:24762058
GPR18, the most abundantly overexpressed orphan G-protein-coupled receptor in all melanoma metastases, is constitutively active and inhibits apoptosis, indicating an important role for GPR18 in tumor cell survival. PMID:20880198
N-arachidonylglycine is a natural ligand for GPR18 PMID:16844083

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in midpiece of spermatozoon (at protein level). Most abundant in testis and spleen. Highly expressed in CD4 and CD8-positive T-cells as well as CD19-positive B-cells.

Database Links

HGNC: 4472

UNIGENE: Hs.741589

KEGG: hsa:2841

STRING: 9606.ENSP00000343428

OMIM: 602042

Promotions