Home
Product
Protein
Transmembrane Proteins
Recombinant Human N-acetylaspartate synthetase (NAT8L)

Recombinant Human N-acetylaspartate synthetase (NAT8L)

Code: CSB-CF818738HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4754

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

NAT8L

Uniprot NO.

Q8N9F0

Alternative Names

NAT8L; CML3; N-acetylaspartate synthetase; NAA synthetase; Camello-like protein 3; N-acetyltransferase 8-like protein

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-302

Target Protein Sequence

MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPV AQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLL YALLAALCFAVSRSLLLTCLVPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPP GSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHN YSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLR EE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Plays a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. NAA occurs in high concentration in brain and its hydrolysis plays a significant part in the maintenance of intact white matter. Promotes dopamine uptake by regulating TNF-alpha expression. Attenuates methamphetamine-induced inhibition of dopamine uptake.

Gene References into Functions

Nat8l CpG island methylation ratios were lower in the patients with schizophrenia than in the healthy controls. PMID:27348532
Characterization and recombinant expression of the nat8l gene that codes for ANAT. PMID:26550943
NAA is produced specifically in NSCLC tumors through NAT8L overexpression, and its extracellular secretion can be detected in blood PMID:26511490
This study demonistrated that the human NAT8L gene related to reward dependence, a personality trait, and grey matter volume in the caudate nucleus in healthy subjects, suggesting that NAT8L might also affect human personality PMID:24246274
Nat8l impacts on the brown adipogenic phenotype PMID:24155240
The aim of the present study was to determine which regions of the protein are important for its catalytic activity and its subcellular localization. PMID:21936773
Results indicated that NAT8L, but not NAT14, catalysed the synthesis of NAA from L-aspartate and acetyl-CoA. PMID:19807691

Hide All

Subcellular Location

Cytoplasm. Membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Rough endoplasmic reticulum membrane; Single-pass membrane protein. Note=Its enzymatic activity contribution is quantitatively larger in mitochondrial compartment than in extramitochondrial compartment.

Protein Families

Camello family

Tissue Specificity

Expressed in brain.

Database Links

HGNC: 26742

UNIGENE: Hs.318529

KEGG: hsa:339983

STRING: 9606.ENSP00000413064

OMIM: 610647

Promotions