Home
Product
Protein
Transmembrane Proteins
Recombinant Human Muscarinic acetylcholine receptor M4 (CHRM4)

Recombinant Human Muscarinic acetylcholine receptor M4 (CHRM4)

Code: CSB-CF005384HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6079

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CHRM4

Uniprot NO.

P08173

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-479

Target Protein Sequence

MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is inhibition of adenylate cyclase.

Gene References into Functions

the association of the African-specific CHRM4 SNP with cocaine dependence survived correction for multiple testing PMID:27269905
This study identify suppression of the PVHSIM1-->PAGvl/DR circuit connection as sufficient to induce overeating behavior. PMID:24768300
Data indicate that compounds derived from VU0152100 showed M4 muscarinic receptor (M4 mAChR) direct agoinst properties. PMID:24074052
The data of this study suggested that the rs2067482 polymorphism may help to predict susceptibility to schizophrenia and/or therapeutic responsiveness. PMID:23490763
Use of HM4- and green fluorescent protein-expressing trangenic mice as tissue donors in cell-based therapy validates a rodent model of Huntington disease. PMID:21295605
analysis of allosteric agonism and modulation at the M4 muscarinic acetylcholine receptor PMID:20406819
relative to other muscarinic receptor subtypes, the M(4) receptor could be the subtype which is selectively compromised in Alzeheimer's disease PMID:12505680
M4 increases expression of "migratory" integrins; M4 effects resulted from inhibition of the inhibitory pathway involving the adenylyl cyclase-cyclic AMP-protein kinase A pathway PMID:15263021
In progressive supranuclear palsy: there were no changes in M4 muscarinic receptor density PMID:18282687
Regions in i3 including Leu272-Arg338 and Val373-Ala393 are involved in internalization of the M4 receptor; the region including Val373-Ala393 is indispensable for its recycling, whereas the other regions are dispensable for internalization and recycling. PMID:18337477