Recombinant Human Dicarboxylate carrier SLC25A8 (UCP2)

Code: CSB-CF025555HU
Size:
20μg
20μg100μg
US$5769
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
UCP2
Uniprot NO.
Alternative Names
UCP2; SLC25A8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8; UCPH
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-309
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYR GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Gene References into Functions
  1. rs1800849 in UCP3 were significantly associated with prediabetes in a rural Chinese population. Overweight modified the effect of rs660339 of UCP2 on type 2 diabetes. These findings suggested that rs1800849 in UCP3 and rs660339 in UCP2 might play an important role in the incidence and development of type 2 diabetes. PMID:29529994
  2. Data do not support the role of variants in UCP2 as a monogenic cause of hyperinsulinaemic hypoglycaemia. PMID:28681398
  3. Aspergillus protease-mediated mitochondrial Reactive Oxygen Species (ROS) production was associated with downregulation of uncoupling protein (UCP)-2 expression by TGF-beta-SMAD4 signaling, which may play a regulatory role in mitochondrial ROS formation during fungal protease-mediated epithelial inflammation. PMID:30007886
  4. UCP2-866 G/A polymorphism is associated with obesity. PMID:29634487
  5. Dats suggest that UCP2 levels in peripheral blood mononuclear cells of obese women with low REE (resting energy expenditure) are significantly lower compared to obese women with low REE and compared to normal weight women. PMID:29017362
  6. The A/A genotype was found to be an independent marker of good prognosis after adjustment for secondary variables (age, sex, glucose level, NIHSS score at baseline, complete recanalization and early neurological improvement) in a logistic regression analysis. The AA genotype of UCP2-866 may predict a better functional outcome in ischemic stroke after recanalization of proximal MCA occlusion. PMID:29043564
  7. UCP2 inhibits myointimal hyperplasia after vascular injury, probably through suppressing nuclear factor-kappaB-dependent smooth muscle cell proliferation and migration. PMID:29025747
  8. Study shows that the mitochondrial uncoupling protein 2 rs659366 A allele and rs660339 T allele are both related to longer leukocyte telomere in subjects without diabetes, independent of cardiovascular risk factors. PMID:27615599
  9. Evaluated association between nonalcoholic fatty liver disease (NAFLD) and single nucleotide polymorphism 866G of human uncoupling protein 2 (UCP2). PMID:27794526
  10. The present study identified a novel gene, UCP2, that influences the serum urate concentration and the risk of hyperuricemia, and the degree of association varies with gender and BMI levels. PMID:27273589
  11. UCP2 regulates the activity of SIRT3 through sensing the energy level and, in turn, maintaining the mitochondrial steady state, which demonstrates a cytoprotective effect on ischemia-reperfusion injury. PMID:28737710
  12. UCP2 is a key mediator of hypoxia-triggered chemoresistance in non-small cell lung cancer cells via repression of peroxisome proliferator-activated receptor gamma. PMID:28042952
  13. Results here presented suggest that UCP variability has different pleiotropic effects, by affecting both telomere length and glucose homeostasis, likely through an influence on energy metabolism and stress response PMID:28281015
  14. UCP2 expression is associated with weight loss after hypocaloric diet intervention. PMID:27759071
  15. Decreased UCP2 gene expression in mononuclear cells from obese and diabetic patients might contribute to the immunological abnormalities in these metabolic disorders and suggests its role as a candidate gene in future studies of obesity and diabetes. PMID:29151065
  16. UCP2 stimulates hnRNPA2/B1, GLUT1 and PKM2 expression and sensitizes pancreatic cancer cells to glycolysis inhibition. PMID:27989750
  17. The data indicate that in the context of hepatocellular carcinoma, miR-214 acts as a putative tumour suppressor by targeting UCP2 and defines a novel mechanism of regulation of UCP2. PMID:27129291
  18. UCP2 inhibition triggered cellular apoptosis and autophagy. PMID:28089824
  19. Expression of UCP2 and PLIN1 genes influences the resting metabolic rate in obese individuals and could predict the weight loss after bariatric surgery. PMID:27376365
  20. The lack of association with ECG derived QTd and UCP2 DD may suggest that gene-related QRS duration prolongation is independent of cardiac hypertrophy. PMID:27875726
  21. Cellular feedback regulation may occur between UCP2/UCP3 and ACE. Cellular UCP regulation of sACE suggests a novel means of crosstalk between (and mutual regulation of) cellular and endocrine metabolism. PMID:27417115
  22. our study provides evidence that the genetic risk factors for healthy aging differ in males and females, as expected from the differences in the phenotypes associated with healthy aging between the two sexes. It also has implications for how mitochondrial function changes during aging. PMID:26965008
  23. Study reports that insulin resistance-related gene polymorphisms effects colorectal cancer (CRC) risk. The results showed that the gene polymorphism of ADIPOQ rs2241766 was associated with CRC risk. Furthermore, the interactions of ADIPOQ rs2241766, UCP2 rs659366, FABP2 rs1799883 and red meat consumption may contribute to the risk of CRC. PMID:23826253
  24. the major components of metabolic syndrome in patients with non-alcoholic fatty liver disease (NAFLD) and nutritional intakes according to different genotype of uncoupling protein-2 (UCP2) -866G/A gene polymorphism in these patients, are reported. PMID:27301474
  25. Data suggest that UCP2 is an important regulator of mitochondrial redox status and lipid signaling, and that hydrogen peroxide might mediate UCP2's tumor promoting activity in skin. PMID:28574619
  26. our data revealed that COL1A1, UCP2, and PRPF40A are novel players implicated in the complex network of hypoxia response in non-small cell lung cancer PMID:28258342
  27. effects of UCP2 polymorphisms on the brain PMID:28771482
  28. genetic association studies on population in Brazil: Data suggest that a missense mutation (rs660339, Ala55Val) and an SNP (rs659366, -866G>A) in UCP2 are associated with weight loss in patients with morbid obesity following Roux-en-Y gastric bypass; individuals who carry T (CT+TT) and A (GA+AA) mutated alleles for Ala55Val and -866G>A, respectively, exhibit higher weight loss and fat-free mass loss. PMID:27743836
  29. Dominant UCP2 mutations are a more important cause of congenital hyperinsulinism than has been recognized and that affected individuals are markedly hypersensitive to glucose-induced hypoglycemia. PMID:27967291
  30. UCP2 has an apoptotic effect in beta cells via regulation of the intrinsic pathway of apoptosis in brain dead organ donors. PMID:28222054
  31. genetic association studies in population in Brazil: Data suggest that two SNPs in UCP2 (rs660339, Ala55Val; rs659366, -866G>A) are associated with ability of patients to comply with dietary restrictions follow bariatric surgery for morbid obesity; thus, UCP2 may be involved in appetite regulation and/or satiety response. PMID:27256164
  32. The 'AA' genotype of UCP2 promoter gene polymorphism G to A at - 866 position revealed 12.39 folds risk for presbycusis. PMID:27562082
  33. Estrogens may increase mitochondrial reactive oxygen species production by repressing uncoupling proteins including UCP2. PMID:26450681
  34. UCP2 as a selective modulator of single channel MCU dependent mitochondrial Ca2+ inward current. PMID:26275882
  35. GTPBP3 plays a role in the regulation of UCP2 protein through AMPK signaling. PMID:26642043
  36. We conclude that UCP2 neither mediates palmitate-induced mitochondrial ROS generation and the associated cell loss, nor protects against these deleterious effects. Instead, UCP2 dampens palmitoleate protection against palmitate toxicity. PMID:25482405
  37. UCP2 is expressed in human cumulus cells. PMID:26356408
  38. Higher UCP2 expression corresponded with a poorer prognosis in breast cancer patients. PMID:25960046
  39. Data reported here suggest that the UCP2 -866A/55Val/Ins haplotype is associated with an increased risk for DKD and with a lower eGFR in T2DM patients PMID:26218518
  40. Dissipation of the proton gradient by Ucp2 is not the only determinant of the phagocytic capacity and that anion transfer or nucleotide binding by Ucp2 is also essential for Ucp2-mediated engulfment of apoptotic cells. PMID:26082030
  41. ectopic overexpression of UCP2 in a HCC cell line with low endogenous UCP2 expression, HLE, significantly decreased mitochondrial superoxide induction by the anti-cancer drug GEM. PMID:26181366
  42. exogenous expression of miR133a or knockdown of UCP-2 in MCF-7/Dox cells can sensitize their reaction to the treatment of Doxorubicin PMID:26107945
  43. Findings in 20 242 individuals suggest that UCP2 gene polymorphisms may cause liver dysfunction through the interaction with body fat rather than alcohol intake. PMID:26526553
  44. In the face of high glucose threat, mitochondrial UCP2 gene expression is regulated by miR-2909 and AATF. PMID:25976474
  45. UCP2 -866 A/A genotype is associated with increased hepatic UCP2 expression and reduced risk of nonalcoholic steatohepatitis, particularly in subjects with normal fasting glucose. PMID:25351290
  46. UCP2 may be implicated in the pathogenesis of type 2 diabetes mellitus and diabetic retinopathy in Chinese population. PMID:25396419
  47. The UCP-2 exon 8 del/ins polymorphism was associated with higher degree of obesity, insulin resistance, dyslipideamia and lower adjusted metabolic rate. PMID:25081806
  48. Polymorphism of UCP2 gene is being associated with obesity and diabetes mellitus type 2 among residents of the Moscow Region. PMID:26402942
  49. The meta-analysis detected a significant association between the UCP2-866G/A, Ins/Del, Ala55Val and UCP3-55C/T polymorphisms and BMI mean differences. PMID:24804925
  50. UCP2 may function as a sensor and negative regulator of mitochondrial ROS production in response to hyperglycemia. PMID:25910810

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Widely expressed in adult human tissues, including tissues rich in macrophages. Most expressed in white adipose tissue and skeletal muscle.
Database Links

HGNC: 12518

UNIGENE: Hs.80658

KEGG: hsa:7351

STRING: 9606.ENSP00000312029

OMIM: 601693

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products