Recombinant Human Melatonin-related receptor (GPR50)

Code: CSB-CF622668HU
Size:
20μg
20μg100μg
US$7111
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
GPR50
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-617
Target Protein Sequence
MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLR NSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIV AIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIF NYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMF VIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNEN FRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQDRAHACPAVEE TPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGH HVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELS ASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDY HDVVVIDVEDDPDEMAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Does not bind melatonin.
Gene References into Functions
  1. GPR50 is a TbetaRI co-receptor with potential impact on cancer development PMID:29572483
  2. Pre-eclampsia (PE) plasma IgG1 anti-Epstein-Barr virus nuclear antigen 1 (EBNA-1) antibody cross-reacts with placental protein G protein-coupled receptor 50 (GPR50). PMID:27181993
  3. The results provide deeper insight into the functional evolution of GPR50 in mammals at the molecular level PMID:25730005
  4. There was only weak female-specific association between GPR50 variants in late-life depression. No significant associations were observed in men. PMID:25798330
  5. study found an association between Seasonal Affective Disorder (SAD) and a single nucleotide polymorphism (intronic rs2072621) of the gene encoding GPR50 in females. PMID:21565467
  6. Positive expression of melatonin receptor can be found in human hypertrophic scar and normal skin, but it is higher in scar. PMID:20737950
  7. we found 2 polymorphisms in the GPR50 receptor of patients with adolescent idiopathic scoliosis, but they were not present at a highly significant frequency when compared with controls PMID:20733416
  8. Antibodies were used to study the expression of GPR50 in mouse, rat and human hypothalamus.GPR50 immunoreactivity (ir) was observed in dorsomedial hypothalamic (DMH) cells and in cells of the ependymal layer of the third ventricle of the hypothalamus. PMID:20210849
  9. This is the first association of rs1202874 with BD and is the second positive association at the GPR50 locus. PMID:20371266
  10. Results identify neurite outgrowth inhibitor NOGO-A as an interacting partner of GPR50 and found an enrichment of both Gpr50 and neuronal Nogo-A at the synapse. PMID:19699797
  11. Polymorphisms in GPR50 were compared in bipolar affective disorder (BD), major depressive disorder (MDD), schizophrenia (SCZ) and controls. GPR50(Delta502-505) or a variant is a sex-specific risk factor for susceptibility to BD and SCZ. PMID:15452587
  12. Results describe sequence variants in the melatonin-related receptor gene (GPR50) that associate with circulating triglyceride and HDL levels. PMID:16436372
  13. GPR50, an orphan GPCR, heterodimerizes constitutively and specifically with MT(1) and MT(2) melatonin receptors PMID:16778767
  14. No evidence for an association for this gene with mood disorders in a Hungarian population. PMID:18075476

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Hypothalamus and pituitary.
Database Links

HGNC: 4506

UNIGENE: Hs.567390

KEGG: hsa:9248

STRING: 9606.ENSP00000218316

OMIM: 300207

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products