GPR50; Melatonin-related receptor; G protein-coupled receptor 50; H9
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-617
Target Protein Sequence
MGPTLAVPTPYGCIGCKLPQPEYPPALIIFMFCAMVITIVVDLIGNSMVILAVTKNKKLR NSGNIFVVSLSVADMLVAIYPYPLMLHAMSIGGWDLSQLQCQMVGFITGLSVVGSIFNIV AIAINRYCYICHSLQYERIFSVRNTCIYLVITWIMTVLAVLPNMYIGTIEYDPRTYTCIF NYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAARDPAGQNPDNQLAEVRNFLTMF VIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYFIAYFNSCLNAVIYGLLNEN FRREYWTIFHAMRHPIIFFSGLISDIREMQEARTLARARAHARDQAREQDRAHACPAVEE TPMNVRNVPLPGDAAAGHPDRASGHPKPHSRSSSAYRKSASTHHKSVFSHSKAASGHLKP VSGHSKPASGHPKSATVYPKPASVHFKADSVHFKGDSVHFKPDSVHFKPASSNPKPITGH HVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELS ASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDY HDVVVIDVEDDPDEMAV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
GPR50 is a TbetaRI co-receptor with potential impact on cancer developmentPMID:29572483
Pre-eclampsia (PE) plasma IgG1 anti-Epstein-Barr virus nuclear antigen 1 (EBNA-1) antibody cross-reacts with placental protein G protein-coupled receptor 50 (GPR50).PMID:27181993
The results provide deeper insight into the functional evolution of GPR50 in mammals at the molecular levelPMID:25730005
There was only weak female-specific association between GPR50 variants in late-life depression. No significant associations were observed in men.PMID:25798330
study found an association between Seasonal Affective Disorder (SAD) and a single nucleotide polymorphism (intronic rs2072621) of the gene encoding GPR50 in females.PMID:21565467
Positive expression of melatonin receptor can be found in human hypertrophic scar and normal skin, but it is higher in scar.PMID:20737950
we found 2 polymorphisms in the GPR50 receptor of patients with adolescent idiopathic scoliosis, but they were not present at a highly significant frequency when compared with controlsPMID:20733416
Antibodies were used to study the expression of GPR50 in mouse, rat and human hypothalamus.GPR50 immunoreactivity (ir) was observed in dorsomedial hypothalamic (DMH) cells and in cells of the ependymal layer of the third ventricle of the hypothalamus.PMID:20210849
This is the first association of rs1202874 with BD and is the second positive association at the GPR50 locus.PMID:20371266
Results identify neurite outgrowth inhibitor NOGO-A as an interacting partner of GPR50 and found an enrichment of both Gpr50 and neuronal Nogo-A at the synapse.PMID:19699797
Polymorphisms in GPR50 were compared in bipolar affective disorder (BD), major depressive disorder (MDD), schizophrenia (SCZ) and controls. GPR50(Delta502-505) or a variant is a sex-specific risk factor for susceptibility to BD and SCZ.PMID:15452587
Results describe sequence variants in the melatonin-related receptor gene (GPR50) that associate with circulating triglyceride and HDL levels.PMID:16436372
GPR50, an orphan GPCR, heterodimerizes constitutively and specifically with MT(1) and MT(2) melatonin receptorsPMID:16778767
No evidence for an association for this gene with mood disorders in a Hungarian population.PMID:18075476