MTNR1B; Melatonin receptor type 1B; Mel-1B-R; Mel1b receptor
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-362
Target Protein Sequence
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD AL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
High affinity receptor for melatonin. Likely to mediate the reproductive and circadian actions of melatonin. The activity of this receptor is mediated by pertussis toxin sensitive G proteins that inhibit adenylate cyclase activity.
Gene References into Functions
Genome-wide significant (P < 5 x 10(-8) ) interaction with MTNR1B and joint effects were detected for CMIP intronic rs17197883.PMID:29691896
The reduced titer of melatonin, along with altered fasting blood glucose due to MTNR1B genetic variant, acts as a risk factor towards type 2 diabetes in the Gujarat population of India.PMID:29674279
that MTNR1B and IRS2 gene variants impacted epicardial fat thickness, lipid profile and glucose homeostasisPMID:28708046
melatonin stimulates PINK1 expression via an MT2 /Akt/NF-kappaB pathway, and such stimulation is important for the prevention of neuronal cell apoptosis under high glucose conditions.PMID:28580603
MTNR1B rs10830963 polymorphism is associated with gestational diabetes susceptibility, and women with a higher number of G alleles have an increased risk of gestational diabetes development.PMID:28084098
In women with psychosis, troponin T levels were associated with genetic variants in MTNR1B.PMID:28167435
The present data suggested that MTNR1B polymorphisms could influence the clinical features in lupus patients, and especially the susceptibility to leucopeniaPMID:27115109
MTNR1B rs10830963/G variant is associated with gestational diabetes binary and glycemic traits in the Caucasian case-control study.PMID:28072873
the risk allele (G allele) of rs10830963 and (T allele) of rs1387153 in MTNR1B lead to a higher risk for gestational diabetes mellitusPMID:26563312
Our results provide the surprising insight that the MTNR1B risk allele influences dynamics of melatonin secretion, generating a novel hypothesis that the MTNR1B risk allele may extend the duration of endogenous melatonin production later into the morning and that early waking may magnify the diabetes risk conferred by the risk allele.PMID:26868293
Insomnia does not mediate or modify the association between MTNR1B risk variant rs10830963 and glucose levels.PMID:26912228
finding suggests that the MTNR1B-dependent vulnerability for elevated fasting plasma glucose levels is shared between bipolar disorder and schizophreniaPMID:26991397
For the first time, we show that Cry 2 rs2292910 and MTNR1B rs3781638 are associated with osteoporosis in a Chinese geriatric cohort.PMID:26564225
rs10830963 polymorphism was not associated with polycystic ovary syndrome in Han Chinese.PMID:26519818
Authors investigated the association between rs4753426 single nucleotide polymorphisms in the melatonin receptor 1B (MTNR1B) gene and the risk of developing gestational diabetes mellitus (GDM).PMID:26345809
Increases in islet MTNR1B expression is associated with type 2 diabetes susceptibility.PMID:26551672
This systematic review was a comprehensive analysis of the currently available evidence, and found an overall significant association of rs4753426 polymorphism with the risk of--{REVIEW}PMID:26431121
results indicate, for the first time, the presence of a functional circadian clock in the human myometrium with the hMTNR1B gene as a clock controlled target.PMID:25939854
MTNR1B rs4753426 and MTNR1B rs10830963 polymorphisms are not obviously associated with risk of AIS in either Asian populations or Caucasian populations.PMID:25898821
rs10830963 MTNR1B polymorphism could be associated with individual differences in weight loss induced by a hypocaloric dietPMID:25870980
MTNR1B rs10830963 risk variant worsens the effect of melatonin on glucose tolerancePMID:26440713
these observations suggest a biologically plausible season-dependent association between SNPs at CRY1, CRY2 and MTNR1B and glucose homeostasis.PMID:25707907
It has been shown for the first time in obese youth that the MTNR1B variant is associated with an increased risk of IFGPMID:25919927
our study found that the genetic polymorphisms rs10830963 and rs1387153 in MTNR1B and rs1801278 in IRS1 were associated with an increased risk of developing GDM.PMID:25146448
Carriers of the G allele of MTNR1B rs10830963 are more likely to develop gestational diabetes than carriers of the C allele.PMID:25982863
results obtained are suggestive of MTNR1B role in T2D etiology, they need to be confirmed with much larger sample sizesPMID:25922310
cross-talk mediated via physical association of melatonin MT2 and 5-HT2C receptors into functional heteromersPMID:25770211
The extent of receptor internalization for the human MT2 receptor is independent of the intrinsic efficacy of agonists and provide novel insights into the controversial relationship between intrinsic agonist efficacy and agonist-induced internalizationPMID:25059758
the association between the common MTNR1B rs10830963 variation and fasting plasma glucose levels in BH population.PMID:24710643
We conclude that variation in MTNR1B contributes to the absolute level of insulin secretion but not to differences in the temporal rate of change in insulin secretion.PMID:24728128
High expression for MT2 receptor is associated with gastric adenocarcinoma.PMID:24142542
14 mutants with loss of Gi protein activation that associate with increased risk of type 2 diabete development (Review)PMID:23798576
Genetics of MTNR1B point to impact of the melatonin signalling pathway for BP and left ventricular function.PMID:23611530
GCKR rs780094 variant confers high cross-ethnicity risk for the development of T2DM, while significant associations between GCK, MTNR1B and G6PC2 variants and T2DM risk are limited to Caucasians.PMID:23840762
Our data indicate that variants in the circadian-related genes CRY2 and MTNR1B may affect long-term changes in energy expenditure, and dietary fat intake may modify the genetic effects.PMID:24335056
genetic association study in women in Finland: Data suggest that 2 SNPs in MTNR1B (rs10830963; rs1387153) are associated with gestational diabetes (and type 2 diabetes, as shown in previous studies); down-regulation of insulin secretion is related.PMID:23761423
The rs10830963 MTNR1B polymorphism is a risk factor for developing impaired glucose regulation and type 2 diabetes mellitus. (Meta-analysis)PMID:23226241
There is a strong association of rs1374645 polymorphism with low fasting blood glucose levels in the low BMI group compared to the high BMI group.PMID:21558052
Investigated whether genetic variants in MTNR1B were associated with delirium; none of the 5 single nucleotide polymorphisms tested were found to be associated with the occurrence of delirium.PMID:22759724
The MTNR1B is likely to be involved in the regulation of glucose homeostasis during pregnancy.PMID:22768333
These data showing the association of polymorphisms in the TPH2 and MTNR1B genes with the progressive subtypes of multiple sclerosis and disability suggest dysregulation in melatonin pathwayPMID:22698518
This study confirms the association of gestational diabetes mellitus with the rs10830963 variant in a sample of the Greek population.PMID:22450346
Rare MTNR1B variants impairing melatonin receptor 1B function contribute to type 2 diabetes.PMID:22286214
Six SNP(rs7754840 in CDKAL1, rs391300 in SRR, rs2383208 in CDKN2A/2B, rs4402960 in IGF2BP2, rs10830963 in MTNR1B, rs4607517 in GCK)risk alleles of type 2 diabetes were associated with GDM in pregnant Chinese women.PMID:22096510
The results of this study suggested that the Single nucleotide polymorphisms MT(2) receptor gene influence the risk of recurrent depressive disorder.PMID:21353709
The rs10830963 polymorphism in MTNR1B was associated with increased fasting glucose and risk of impaired fasting glucose in Chinese children and adolescents.PMID:21701235
The G-allele of rs10830693 in the MTNR1B gene was significantly related to glucose levels, while an impact of this genetic variant on the changes in glucose metabolism in children participating in a lifestyle intervention was not observable.PMID:21366812
There is no effect by the common gene variant rs10830963 of the melatonin receptor 1B on the association between sleep disturbances and type 2 diabetes.PMID:21380592
There were significant associations between the two genetic variants (rs10830963 and rs1387153) of the melatonin receptor 1B gene and gestational diabetes mellitus.PMID:21658282
The rs3781637 A/G polymorphism of the MTNR1B gene is associated with type 2 diabetes, plasma, total cholesterol and LDL-C levels in the Han Chinese population.PMID:21470412
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in retina and less in brain and hippocampus.