Home
Product
Protein
Transmembrane Proteins
Recombinant Human Melanin-concentrating hormone receptor 2 (MCHR2)

Recombinant Human Melanin-concentrating hormone receptor 2 (MCHR2)

Code: CSB-CF013585HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5039

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

MCHR2

Uniprot NO.

Q969V1

Alternative Names

MCHR2; GPR145; SLT; Melanin-concentrating hormone receptor 2; MCH receptor 2; MCH-R2; MCHR-2; G-protein coupled receptor 145; GPRv17; MCH-2R; MCH2; MCH2R

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-340

Target Protein Sequence

MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for melanin-concentrating hormone, coupled to G proteins that activate phosphoinositide hydrolysis.

Gene References into Functions

evidence for the involvement of duplications in MCHR2 in alopecia areata pathogenesis in a Central European cohort PMID:27306922
This study provides new insights on the possible influence of MCHR2 and/or MCHR2-AS1 on obesity in psychiatric patients and on the pathophysiology of atypical depression. PMID:26461262
Discovery and characterization of a potent and selective antagonist of melanin-concentrating hormone receptor 2 PMID:22123324
construction of the CHO cell line and the research of MCHR2 molecular characteristics have established a good experimental basis for the further research about the function of MCHR2 gene PMID:20099459
MCH1 and MCH2 receptors were investigated and are different from those in SVK14 cells. PMID:12127971
results of molecular simulations of MCHR2 in the free and hormone-bound forms provide suggestions on the amino acids responsible for the transfer of the structural changes from the agonist binding site to the G-protein coupling domains PMID:15229878
MCHR2 is not a major contributor to polygenic obesity PMID:17698913
MCHR2 positively mediates the regulation of melanin-concentrating hormone during preadipocyte differentiation and is involved in energy balance regulation without affecting preadipocyte proliferation. PMID:19683862
The 10-amino-acid cyclic core of the hMCH neuropeptide with the Arg attached to the N-terminus of the disulfide ring is sufficient for full activation of melanin-concentrating hormone receptor 2. PMID:11478907

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Specifically expressed in the brain, with highest levels in cerebral cortex, hippocampus and amygdala. No expression detected in the cerebellum, thalamus or hypothalamus.

Database Links

HGNC: 20867

UNIGENE: Hs.591342

KEGG: hsa:84539

STRING: 9606.ENSP00000281806

OMIM: 606111

Promotions