FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Ligand of the T-lymphocyte CD2 glycoprotein. This interaction is important in mediating thymocyte interactions with thymic epithelial cells, antigen-independent and -dependent interactions of T-lymphocytes with target cells and antigen-presenting cells and the T-lymphocyte rosetting with erythrocytes. In addition, the LFA-3/CD2 interaction may prime response by both the CD2+ and LFA-3+ cells.
Gene References into Functions
indicate that including both CD58 and CD81 markers in addition to CD19, CD34, CD20, CD38, and CD10 are helpful in minimal residual disease detection by flow cytometryPMID:29500862
Mutations and copy number loss of CD58 or TP53 are identified to be an independent negative prognostic factors for diffuse large B cell lymphoma.PMID:27825110
A new neuromyelitis optica spectrum disorders susceptibility variant was identified, rs56302466, on the CD58 gene, in a Han Chinese population.PMID:28601281
data suggest that loss of CD58 is a potential immune escape mechanism of HL tumor cells, especially in clinically aggressive diseasePMID:27467287
Cytometry analysis evidenced a specific expression profile on reticulocytes of SCA infants, with notably an increased expression of the adhesion molecules Lu/BCAM, ICAM-4 and LFA-3, both in percentage of positive cells and in surface density.PMID:26137540
Frequent inactivating mutations of CD58 in classical Hodgkin lymphoma cell lines, but their rare occurrence in primary Hodgkin and Reed/Sternberg cells.PMID:26194173
SNPs in CD58 are associated with increased risk of candidemia.PMID:25197941
This study demonstrated that the Polymorphism, Single Nucleotide of CD58 is associated with multiple sclerosis in man in Russia.PMID:25903733
Results indicate that CD58 is a novel cell-surface marker that functionally regulates self-renewal of Colorectal tumor-initiating cells.PMID:24727892
Linkage disequilibrium show evidence that mir-548ac rs1414273 variant is strongly associated with Multiple sclerosis (MS)-associated haplotype and confirms the single nucleotide polymorphisms within the first intron of CD58 been related too. [review]PMID:25795118
The positive correlation is established between content of polymorphic nuclear monocytes and level of expression of molecules of LFA-1, ICAM-1, LFA-3, and PECAM-1.PMID:25884075
Genetic variations in CD58 were associated with the susceptibility of neuromyelitis optica in a Korean population.PMID:24655566
In 21 percent of diffuse large B cell lymphoma cases, lesions involve the CD58 gene, which encodes a molecule involved in T and natural killer cell-mediated responsesPMID:22137796
Two large cohorts of systemic sclerosis (SSc) patients of European Caucasian ancestry do not support the implication of ITGAM, ITGAX, and CD58 genes in the genetic susceptibility of SSc, although they were identified as autoimmune disease risk genes.PMID:21362770
Seven selected CD58 single-nucleotide polymorphisms were found to not affect aspirin-exacerbated respiratory disease susceptibility in a Korean population.PMID:21726122
Studies indicate that SNP in IL7RA, IL2RA, CD58 and CLEC16A genes has been consistently associated with MS.PMID:20450971
Data show that coculture with activated T cells upregulated expression of CD54 and CD58 and secretion of galectin-1 by MSCs.PMID:20570633
Studies indicate that five SNPs showed genome-wide significant association with MS: HLA-DRA, IL7R, IL2RA, CD58 and CLEC16A.PMID:19834503
Signal-dependent adhesion of resting NK cells initiated by expression of ICAM-1 is greatly enhanced by coexpression of LFA-3, even in the absence of cytokines.PMID:12496412
The complement inhibitor CD59 and the lymphocyte function-associated antigen-3 (LFA-3, CD58) genes possess functional binding sites for the p53 tumor suppressor protein.PMID:12553064
Transmembrane CD58 may trigger signaling independently of the GPI-linked isoform.PMID:15093607
Human cells transformed with Ad12 demonstrated reduced expression of cell surface LFA-3.PMID:15963548
The level of CD58 molecule (in both serum and PBMC form) of patients with hepatitis B is related to the degree of liver damage.PMID:16830383
Susceptibility gene for multiple sclerosis in Australians.PMID:18650830
We found variable, but persistently elevated levels of sLFA-3 throughout the various phases and types of the hemorrhagic fever with renal syndrome, which suggest that sLFA-3 levels have correlation with disease stages.PMID:18820826
Cross-linking of CD58 induces protein tyrosine phosphorylation of BLNK, Syk and PLCgamma, and activation of ERK and Akt/PKB.PMID:19268704
Study reports additional genetic and transcriptomic evidence for the role of CD58 (LFA-3) in multiple sclerosis (MS) susceptibility using a Swedish case-control material, with a result that closely mimics that of De Jager et al.PMID:19497873
Genetic variants at CD58, is associated with rheumatoid arthritis riskPMID:19898481
Show
More
Hide
All
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.