MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Low-affinity receptor for leukotrienes including leukotriene B4. Mediates chemotaxis of granulocytes and macrophages. The response is mediated via G-proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTB4 > 12-epi-LTB4 > LTB5 > LTB3.
Gene References into Functions
In a group of 545 breast cancer patients with metastasis, authors observed that the high-BLT2 subgroup had a lower disease-free-survival rate than the low-BLT2 subgroup.PMID:29898809
BLT2 gene polymorphism (D196G) enhances ligand sensitivity, thereby increasing cell motility in response to low-dose ligand stimulation.PMID:29170475
Leukotriene B4 receptor type 2 protects against pneumolysin-dependent acute lung injury.PMID:27703200
BLT2 ligation facilitates F-actin assembly with the upregulated phosphorylation of MYPT1.PMID:26896822
Supernatants and lipids from stored red blood cells activate pulmonary microvascular endothelium through the BLT2 receptorPMID:28880373
RanBPM acts as a negative regulator of BLT2 and IL8, thus attenuating the invasiveness of aggressive breast cancer cellsPMID:28027932
BLT2 inhibition induces apoptosis, inhibits proliferation, colony formation and self-renewal capacity of CD34(+) cells from tyrosine kinase inhibitor - resistant blast phase-chronic myeloid leukemia patients.PMID:26966074
Data show that signal transducer and activator of transcription-3 (STAT-3) activation occurs downstream of leukotriene B4 receptor-2 (BLT2) and mediates cisplatin resistance in SK-OV-3 cells.PMID:26597704
Authors demonstrated that MyD88 lies upstream of BLT2 in LPS-potentiated invasiveness and that this 'MyD88-BLT2' cascade mediates activation of NF-kappaB and the synthesis of IL-6 and IL-8 critical for the invasiveness and aggression of breast cancer cells.PMID:25691060
BLT1 and BLT2 are therefore potential targets for the development of novel drugs.PMID:25480980
searched BLT2 downstream components and identified reactive oxygen species and nuclear factor kappaB as critical components that contribute to epithelial-mesenchymal transition in mammary epithelial cellsPMID:24990945
BLT2-NOX-ROS-NF-kappaB cascade induction during detachment confers a novel mechanism of anoikis resistance in prostate cancer cells and potentially contributes to prostate cancer progression.PMID:23986446
RanBPM acts as a negative regulator of BLT2 signaling to attenuate BLT2-mediated cell motilityPMID:23928309
Findings indicate that BLT2 has a protective role in allergic airway inflammation and that diminished BLT2 expression in CD4(+) T cells may contribute to the pathophysiology of asthma.PMID:23603839
BLT2 is a novel therapeutic target that sensitises drug-resistant breast cancer cells to paclitaxel.PMID:23799854
Findings suggest that, in bronchial epithelial cells, cigarette smoke extracts (CSE) promote induction of pro-inflammatory BLT2 receptors and activate mechanisms leading to increased neutrophil adhesion.PMID:23347335
our study demonstrates that a BLT2 up-regulates IL-8 production , thereby contributing to the invasiveness of these aggressive breast cancer cells.PMID:23145117
LTB4R2 shows splice variation in the 5'-untranslated region and multiple promoter regions. LTB4R2 polymorphisms do not appear to be susceptibility markers for the development of asthma in Caucasian subjects.PMID:23167751
The results suggested that LTB4 receptors BLT1 and BLT2 are involved in IL-8 production in and secretion by human neutrophils induced by T. vaginalis.PMID:22215047
Leukotriene B4 receptor-2 promotes invasiveness and metastasis of ovarian cancer cells through signal transducer and activator of transcription 3 (STAT3)-dependent up-regulation of matrix metalloproteinase 2PMID:22396544
these findings point to BLT2 as a key regulator of AR expression and will contribute to the development of novel therapies for AR-positive prostate cancers, including androgen-responsive and castration-resistant prostate cancers.PMID:22426480
BLT2 phosphorylation at Thr355 by Akt is necessary for BLT2-mediated chemotaxisPMID:22044535
Up-regulation of BLT2 is associated with bladder cancer.PMID:21252614
BLT2-Nox1-reactive oxygen species-dependent pathway plays a role in promoting the secretion of IL-8 from human mast cells in response to the proinflammatory cytokine IL-1beta, thus contributing to angiogenesis.PMID:20194723
a "BLT2-Nox1"-linked pathway has a crucial role in UVB-induced ROS generation and mediates apoptosis in human keratinocytesPMID:20090768
the 'BLT2-Nox1-ROS'-linked cascade is involved in the pro-survival signaling, especially in ER-negative breast cancer cells.PMID:19748928
BLT2 stimulates the purified G alpha(i2) beta(1) gamma(2) protein more efficiently than the dimer; assembly of two BLT2 protomers into a dimer results in the reduced ability to signalPMID:20026606
BLT2 plays a pivotal, mediatory role in the pathogenesis of asthma, acting through a "reactive oxygen species-NF-kappaB"-linked inflammatory signaling pathway.PMID:19448154
BLT2 is a low-affinity leucotriene B4 receptor; 358 amino acid sequence is 92.7% identical to the mouse receptorPMID:12895595
BLT2 (the low-affinity receptor for LTB4) showed stronger expression than BLT1 (the high-affinity receptor) in actively inflamed synovial tissue from patients with rheumatoid arthritisPMID:12913925
LTB4-BLT2-linked cascade plays a crucial mediatory role in the cell transformation induced by oncogenic Ha-Ras(V12), possibly acting downstream of Rac-cPLA2PMID:15489890
Data indicate that expression of functional leukotriene B4 receptors (BLT1 and 2) may occur at the surface of endothelial cells in response to lipopolysaccharides, cytokines, and LTB4.PMID:16624877
demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells and a regulatory role for stem cell factor in their expressionPMID:16920986
BLT2-Nox1-linked cascade is responsible for the elevated ROS generation in Ras-transformed cells.PMID:18082638
Genetic variation in leukotriene pathway members and their receptors confer an increased risk of ischemic stroke in 2 independent populationsPMID:18323512
BLT2 was expressed in 45% of ovarian neoplasms and correlated with advanced stage III/IV disease, suboptimal debulking, and platinum resistance.PMID:18421027
Upregulation of BLT2 is already evident in precursor lesions (PanINs, IPMNs). Overexpression of this receptor leads to significant growth stimulationPMID:18781173
LTB4 phosphorylates MAPKs and stimulates NF-kappaB-dependent inflammation via BLT1 and BLT2 receptors in cultured monocytic cells. The blockade of this pathway could be a novel and potential therapeutic target in atherothrombosis.PMID:18852255
the response of the pleural mesothelium to LTB4 is the result of a balance between the activation of receptors for LTB4 with a proinflammatory outcome (BLT2) and the activation of a different receptor for LTB4 with an anti-inflammatory outcome (PPAR).PMID:18981151
results suggest that the helix 8 region of hBLT2 plays an important role in transport-competent receptor folding.PMID:19126593
Findings indicate that BLT2 plays an essential role in mediating VEGF-induced angiogenesis.PMID:19286633