Recombinant Human Leukotriene B4 receptor 1 (LTB4R)

CSB-CF624032HU
Size:
20μg
20μg100μg
US$5128
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
LTB4R
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-352
Target Protein Sequence
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Gene References into Functions
  1. fact, leukotriene B4 (LTB4) is an eicosanoid lipid derivative of arachidonic acid, which primarily binds itself to the high-affinity G protein-coupled receptor BLT1. BLT1 plays an indispensable role in atherosclerosis. Hence, the BLT1 antagonist might have a therapeutic role in treating atherosclerosis. [review] PMID:26659842
  2. A novel regulatory mechanism for SNAP23-dependent mast cell activation of T. vaginalis-secreted LTB4 involving surface trafficking of BLT1. PMID:27795355
  3. RAGE has been identified as a novel binding protein for BLT1; RAGE modulates downstream signaling from BLT1 and affects cell migration through BLT1 both in vitro and in vivo. PMID:27830944
  4. Induction of pSmad3L through BLT1-NOX-ROS-EGFR-PI3K-ERK1/2 signaling pathway is a key mechanism by which LTB4 blocks the anti-proliferative responses of TGF-beta1 in breast tumors. PMID:26497676
  5. pro-inflammatory stimuli lead to FPR2/ALX expression while LXA4 induces an anti-inflammatory response PMID:26248046
  6. The BLT1 Inhibitory Function of alpha-1 Antitrypsin Augmentation Therapy Disrupts Leukotriene B4 Neutrophil Signaling. PMID:26371243
  7. increased levels in Chinese children with sleep-disordered breathing PMID:24975656
  8. Results suggest that NOX2-derived ROS-mediated BLT1 trafficking to the cell surface plays a key role in the exocytosis of human eosinophils induced by LTB4. PMID:25323785
  9. we show that orchestrated action of CXCR2 and leukotriene B4 receptor BLT1 plays a key role in neutrophil recruitment during the development of imiquimod (IMQ)-induced psoriatic skin lesions in mice PMID:24663678
  10. A novel method predicts activated structures of G-protein-coupled receptor BLT1 with high accuracy, while aiming for the use of the predicted 3D structures in in silico virtual screening. PMID:23304088
  11. LTB4R1 shows splice variation in the 5'-untranslated region and multiple promoter regions. LTB4R1 polymorphisms do not appear to be susceptibility markers for the development of asthma in Caucasian subjects. PMID:23167751
  12. The LTB(4)-BLT signaling pathway may negatively regulate preadipocyte differentiation via induction of TGFBI expression as a rate-limiting system to control adipocyte differentiation. PMID:23137534
  13. Helix 8 of BLT1 inhibits receptor internalization by suppressing the excessive phosphorylation of the C-terminal tail. PMID:22707565
  14. The results suggested that LTB4 receptors BLT1 and BLT2 are involved in IL-8 production in and secretion by human neutrophils induced by T. vaginalis. PMID:22215047
  15. The polymorphisms spanning LTB4R is not major determinants of baseline lung function in smokers. PMID:22206291
  16. leukotriene B(4) receptors (BLT(1) and BLT(2)) are differently expressed in fibroblast from peripheral versus central airways in asthmatics and healthy controls. PMID:21596548
  17. Upon stimulation with LTB(4) or LPS, more BLT(1) protein is found on HUVEC cells, now evenly distributed over the cytoplasm and in the cell nucleus, but less on the cell surface PMID:20688055
  18. Leukotriene B(4) BLT receptor signaling regulates the level and stability of cyclooxygenase-2 (COX-2) mRNA through restricted activation of Ras/Raf/ERK/p42 AUF1 pathway PMID:20489206
  19. Up-regulation of leukotriene B4 receptor-1 expression by the glucocorticoid dexamethasone provides a mechanism for enhanced LTB4-induced neutrophil survival. PMID:11907121
  20. marked expression of leukotriene B(4) receptor in human pancreatic cancer tissues PMID:12163367
  21. Results show that leukotriene B(4) binds BLT1 and activates G(i)-like protein, and both phosphatidylinositol 3-kinase (PI3-K) activation and a sustained calcium elevation by calcium influx are necessary for enzyme release in these cells. PMID:12244116
  22. an examination of in vivo chemotaxis using CHO cells expressing this receptor PMID:12664610
  23. BLT1 is a high-affinity receptor specific for leukotriene B4 on leukocytes; the 352 amino acid sequence is 78% identical to the mouse receptor PMID:12895595
  24. helix 8 of LTB4 receptor 1 plays an important role in the conformational change of the receptor to the low affinity state after G-protein activation, possibly by sensing the status of coupling Galpha subunits as GTP-bound PMID:12902330
  25. BLT2 (the low-affinity receptor for LTB4) showed stronger expression than BLT1 (the high-affinity receptor) in actively inflamed synovial tissue from patients with rheumatoid arthritis PMID:12913925
  26. Glucocorticoids up-regulate leukotriene B4 receptor-1 expression during neutrophilic differentiation of HL-60 cells PMID:12943671
  27. LTB4R has dileucine motifs and an alpha-helix VIII which regulate its expression PMID:14688279
  28. BLT1 expression in human monocytes is regulated by pro- and anti-inflammatory cytokines, lipopolysaccharide (LPS), and dexamethasone. PMID:15728714
  29. LTB4 production and subsequent activation of the high affinity LTB4 receptor in calcium mobilization of neutrophils. PMID:15789613
  30. essential role for BLT1 in allergen-mediated CD8+ T cell recruitment into the lung and development of airway hyperresponsiveness and inflammation PMID:15814727
  31. LTB(4) activates functional BLT(1) receptors on vascular smooth muscle cells, inducing chemotaxis and proliferation, and that BLT(1) receptors were up-regulated through an Ikappa kinase beta/NF-kappaB-dependent pathway. PMID:16293697
  32. A role for BLT1 is defined using transgenic BLT1-deficient effector CD8-positive T cells that mediate increased airway reactivity when transferred into CD8-deficient mice PMID:16493075
  33. Data indicate that expression of functional leukotriene B4 receptors (BLT1 and 2) may occur at the surface of endothelial cells in response to lipopolysaccharides, cytokines, and LTB4. PMID:16624877
  34. demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells and a regulatory role for stem cell factor in their expression PMID:16920986
  35. This review summarizes the role of the LTB4/BLT1 pathway, an impotant target for the treatment of bronchial asthma. PMID:17075244
  36. The conformational changes in each subunit of a receptor dimer resulting from agonist binding to either one or both subunits by measuring the fluorescent properties of a leukotriene B(4) receptor dimer, was analyzed. PMID:17139258
  37. The extended cytoplasmic helix connected to transmembrane helix V of BLT1 might be a key region for selective activation of the GTP-binding protein Gi alpha subunit. PMID:17158791
  38. The ligand binding site and activation mechanism for BLT1 have been characterized. PMID:17237498
  39. A new class of phospholipid-like surfactants that stabilize the G protein-coupled receptor, BLT1. PMID:17445804
  40. stimulation of neutrophils with LTB(4) (in the presence or absence of CMV) leads to the release of myeloperoxidase, alpha-defensins, eosinophil-derived neurotoxin, and the human cathelicidin LL-37 in a BLT1-dependent manner. PMID:17931111
  41. Genetic variation in leukotriene pathway members and their receptors confer an increased risk of ischemic stroke in 2 independent populations PMID:18323512
  42. BLT1 was expressed in 34% of ovarian neoplasms. PMID:18421027
  43. Report the long-term effect of Helicobacter pylori eradication on COX-1/2, 5-LOX and leukotriene receptors in patients with a risk gastritis phenotype--a link to gastric carcinogenesis. PMID:18571838
  44. increased expression in allergic diseases PMID:18797182
  45. LTB4 phosphorylates MAPKs and stimulates NF-kappaB-dependent inflammation via BLT1 and BLT2 receptors in cultured monocytic cells. The blockade of this pathway could be a novel and potential therapeutic target in atherothrombosis. PMID:18852255
  46. neutrophil-chemotactic activity of the conditioned media from the intraluminal thrombus exhibited major inhibition by antagonists of the leukotriene B(4) receptors PMID:19136615
  47. Introduction of a metal-binding site connecting the third and sixth transmembrane domains of the BLT1 receptor stabilizes its ground state. PMID:19309698

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.
Database Links

HGNC: 6713

UNIGENE: Hs.567248

KEGG: hsa:1241

STRING: 9606.ENSP00000307445

OMIM: 601531

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products