MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Gene References into Functions
fact, leukotriene B4 (LTB4) is an eicosanoid lipid derivative of arachidonic acid, which primarily binds itself to the high-affinity G protein-coupled receptor BLT1. BLT1 plays an indispensable role in atherosclerosis. Hence, the BLT1 antagonist might have a therapeutic role in treating atherosclerosis. [review]PMID:26659842
A novel regulatory mechanism for SNAP23-dependent mast cell activation of T. vaginalis-secreted LTB4 involving surface trafficking of BLT1.PMID:27795355
RAGE has been identified as a novel binding protein for BLT1; RAGE modulates downstream signaling from BLT1 and affects cell migration through BLT1 both in vitro and in vivo.PMID:27830944
Induction of pSmad3L through BLT1-NOX-ROS-EGFR-PI3K-ERK1/2 signaling pathway is a key mechanism by which LTB4 blocks the anti-proliferative responses of TGF-beta1 in breast tumors.PMID:26497676
pro-inflammatory stimuli lead to FPR2/ALX expression while LXA4 induces an anti-inflammatory responsePMID:26248046
The BLT1 Inhibitory Function of alpha-1 Antitrypsin Augmentation Therapy Disrupts Leukotriene B4 Neutrophil Signaling.PMID:26371243
increased levels in Chinese children with sleep-disordered breathingPMID:24975656
Results suggest that NOX2-derived ROS-mediated BLT1 trafficking to the cell surface plays a key role in the exocytosis of human eosinophils induced by LTB4.PMID:25323785
we show that orchestrated action of CXCR2 and leukotriene B4 receptor BLT1 plays a key role in neutrophil recruitment during the development of imiquimod (IMQ)-induced psoriatic skin lesions in micePMID:24663678
A novel method predicts activated structures of G-protein-coupled receptor BLT1 with high accuracy, while aiming for the use of the predicted 3D structures in in silico virtual screening.PMID:23304088
LTB4R1 shows splice variation in the 5'-untranslated region and multiple promoter regions. LTB4R1 polymorphisms do not appear to be susceptibility markers for the development of asthma in Caucasian subjects.PMID:23167751
The LTB(4)-BLT signaling pathway may negatively regulate preadipocyte differentiation via induction of TGFBI expression as a rate-limiting system to control adipocyte differentiation.PMID:23137534
Helix 8 of BLT1 inhibits receptor internalization by suppressing the excessive phosphorylation of the C-terminal tail.PMID:22707565
The results suggested that LTB4 receptors BLT1 and BLT2 are involved in IL-8 production in and secretion by human neutrophils induced by T. vaginalis.PMID:22215047
The polymorphisms spanning LTB4R is not major determinants of baseline lung function in smokers.PMID:22206291
leukotriene B(4) receptors (BLT(1) and BLT(2)) are differently expressed in fibroblast from peripheral versus central airways in asthmatics and healthy controls.PMID:21596548
Upon stimulation with LTB(4) or LPS, more BLT(1) protein is found on HUVEC cells, now evenly distributed over the cytoplasm and in the cell nucleus, but less on the cell surfacePMID:20688055
Leukotriene B(4) BLT receptor signaling regulates the level and stability of cyclooxygenase-2 (COX-2) mRNA through restricted activation of Ras/Raf/ERK/p42 AUF1 pathwayPMID:20489206
Up-regulation of leukotriene B4 receptor-1 expression by the glucocorticoid dexamethasone provides a mechanism for enhanced LTB4-induced neutrophil survival.PMID:11907121
marked expression of leukotriene B(4) receptor in human pancreatic cancer tissuesPMID:12163367
Results show that leukotriene B(4) binds BLT1 and activates G(i)-like protein, and both phosphatidylinositol 3-kinase (PI3-K) activation and a sustained calcium elevation by calcium influx are necessary for enzyme release in these cells.PMID:12244116
an examination of in vivo chemotaxis using CHO cells expressing this receptorPMID:12664610
BLT1 is a high-affinity receptor specific for leukotriene B4 on leukocytes; the 352 amino acid sequence is 78% identical to the mouse receptorPMID:12895595
helix 8 of LTB4 receptor 1 plays an important role in the conformational change of the receptor to the low affinity state after G-protein activation, possibly by sensing the status of coupling Galpha subunits as GTP-boundPMID:12902330
BLT2 (the low-affinity receptor for LTB4) showed stronger expression than BLT1 (the high-affinity receptor) in actively inflamed synovial tissue from patients with rheumatoid arthritisPMID:12913925
Glucocorticoids up-regulate leukotriene B4 receptor-1 expression during neutrophilic differentiation of HL-60 cellsPMID:12943671
LTB4R has dileucine motifs and an alpha-helix VIII which regulate its expressionPMID:14688279
BLT1 expression in human monocytes is regulated by pro- and anti-inflammatory cytokines, lipopolysaccharide (LPS), and dexamethasone.PMID:15728714
LTB4 production and subsequent activation of the high affinity LTB4 receptor in calcium mobilization of neutrophils.PMID:15789613
essential role for BLT1 in allergen-mediated CD8+ T cell recruitment into the lung and development of airway hyperresponsiveness and inflammationPMID:15814727
LTB(4) activates functional BLT(1) receptors on vascular smooth muscle cells, inducing chemotaxis and proliferation, and that BLT(1) receptors were up-regulated through an Ikappa kinase beta/NF-kappaB-dependent pathway.PMID:16293697
A role for BLT1 is defined using transgenic BLT1-deficient effector CD8-positive T cells that mediate increased airway reactivity when transferred into CD8-deficient micePMID:16493075
Data indicate that expression of functional leukotriene B4 receptors (BLT1 and 2) may occur at the surface of endothelial cells in response to lipopolysaccharides, cytokines, and LTB4.PMID:16624877
demonstrates expression of functional Leukotriene B4 receptors, both BLT1 and BLT2, in murine and human mast cells and a regulatory role for stem cell factor in their expressionPMID:16920986
This review summarizes the role of the LTB4/BLT1 pathway, an impotant target for the treatment of bronchial asthma.PMID:17075244
The conformational changes in each subunit of a receptor dimer resulting from agonist binding to either one or both subunits by measuring the fluorescent properties of a leukotriene B(4) receptor dimer, was analyzed.PMID:17139258
The extended cytoplasmic helix connected to transmembrane helix V of BLT1 might be a key region for selective activation of the GTP-binding protein Gi alpha subunit.PMID:17158791
The ligand binding site and activation mechanism for BLT1 have been characterized.PMID:17237498
A new class of phospholipid-like surfactants that stabilize the G protein-coupled receptor, BLT1.PMID:17445804
stimulation of neutrophils with LTB(4) (in the presence or absence of CMV) leads to the release of myeloperoxidase, alpha-defensins, eosinophil-derived neurotoxin, and the human cathelicidin LL-37 in a BLT1-dependent manner.PMID:17931111
Genetic variation in leukotriene pathway members and their receptors confer an increased risk of ischemic stroke in 2 independent populationsPMID:18323512
BLT1 was expressed in 34% of ovarian neoplasms.PMID:18421027
Report the long-term effect of Helicobacter pylori eradication on COX-1/2, 5-LOX and leukotriene receptors in patients with a risk gastritis phenotype--a link to gastric carcinogenesis.PMID:18571838
increased expression in allergic diseasesPMID:18797182
LTB4 phosphorylates MAPKs and stimulates NF-kappaB-dependent inflammation via BLT1 and BLT2 receptors in cultured monocytic cells. The blockade of this pathway could be a novel and potential therapeutic target in atherothrombosis.PMID:18852255
neutrophil-chemotactic activity of the conditioned media from the intraluminal thrombus exhibited major inhibition by antagonists of the leukotriene B(4) receptorsPMID:19136615
Introduction of a metal-binding site connecting the third and sixth transmembrane domains of the BLT1 receptor stabilizes its ground state.PMID:19309698
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.