HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Gene References into Functions
Genotypes missing these two inhibitory KIR-HLA combinations in addition to missing activating KIRs 2DS2 and 2DS3 were more common in Vogt-Koyanagi-Harada disease (OR = 1.90, P = 0.002).PMID:27490240
KIR2DS2/HLA-C1 may correlate with Hashimoto thyroiditis in a Chinese population.PMID:27042744
Loss of KIR2DS2 gene is associated with breast cancer.PMID:27631728
association between KIR2DS2 and the response to methotrexate (MTX), moreover, the combination KIR2DL2+/KIR2DS2+ was more frequent in responders to MTX (p = 0.043).PMID:27251940
this study shows that the presence of KIR2DS2 was associated with a worsening of haematopoietic stem cell transplantation from HLA-matched sibling donor for treatment of myeloid malignanciesPMID:27394130
genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north IndiansPMID:26472014
this study was to look for immunogenetic determinants in the pathogenesis of FMF and find out if KIR are related to susceptibility. An activator KIR gene, KIR2DS2, was significantly more frequent in FMF patients (p=0.036).PMID:26574972
a significant increase in the frequency of KIR2DL2 (P = 0.019) as well as KIR2DS2 (P = 0.008) in patients with neuroblastoma compared with the healthy control group, was found.PMID:26202659
Single Nucleotide Polymorphism in KIR2DS2 gene is associated with Asthma and Atopic Dermatitis.PMID:26430804
genetic polymorphism is associated with chronic hepatitis C and levels of viremia in PolandPMID:25636579
KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in Han population.PMID:25575065
CD4(+) CD28(-) cells exhibited increased KIR2DS2, reduced KIR2DL3 and increased DAP12 expression in HD-ESRD compared with NDD-CKD patients.PMID:25484131
Authors showed a significant increased correlation between KIR2DL2/DS2, type 2 diabetes and HLA-C1C1 genotype in the type 2 diabetes patients infected with human herpesvirus 8.PMID:24122895
NK cells with KIR2DS2 immunogenotype have a functional activation advantage to efficiently kill glioblastoma and prolong animal survival.PMID:25381437
There is an association of the KIR2DS gene, especially KIR2DS2, with psoriatic arthritis.PMID:24185760
Activating killer cell immunoglobulin-like receptor 2DS2 binds to HLA-A*11.PMID:24550293
Analysis of this large cohort from Uganda in the context of other African populations reveals variations in KIR and HLA-C1 and C2 that are consistent with migrations within Africa and potential selection pressures on these genes.PMID:23974321
Data indicate that increased frequency of the activating receptor KIR2DS1 and a reduced frequency of the KIR-ligand combination KIR2DS2/2DL2 absent/C1 present were significantly associated with chronic myeloid leukemia (CML).PMID:23380384
presence of KIR2DS2 is associated with rheumatoid arthritis.PMID:22960345
Our data revealed a unique contribution of activating KIRs (KIR2DS4, KIR2DS2, or KIR3DS1), in addition to NKG2C, in the expansion of human natural killer cells.PMID:23325834
in response to HCT therapy, the activating receptors are also enhanced by a process that increases the number of unmethylated sites present on KIR2DS2/4 promoters.PMID:22939905
The frequency of the combination of HLA-C1 allele group with KIR2DS2 was significantly higher in severe dry eye disease patients.PMID:22509813
individuals possessing KIR2DL2 and/or KIR2DS2 (and, in most cases, also KIR2DL1) gene but no HLA-C C2 ligand may respond better to treatment and survive longer than people bearing other genotypes.PMID:22836042
KIR2DS2/KIR2DL2 and HLA-C genotype of rheumatoid arthritis patients may provide predictive information for response to anti-TNF-alpha therapy.PMID:21373785
In a comparison of healthy controls and a tightly defined cohort of adult ITP patients, the KIR2DS2/KIR2DL2 genotype was found to be associated with ITP independently of FCGR3a-158 polymorphisms.PMID:22024796
The CMV seropositivity of donors was not associated with activating KIR expression, and donor null expression in those with the KIR2DS2 or KIR2DS4 genotype was not predictive for CMV reactivation in the recipient.PMID:21596150
This study showed a significantly lower frequency of KIR2DS2 among chronic HCV carriers compared with controls in a Korean populationPMID:22065905
KIR2DS2*005 encodes a molecule expressed on the surface of natural killer- and T-lymphocytes.PMID:21593779
predisposition to systemic lupus erythematosus was associated with GTGT deletion at the SLC11A1 3'UTR, presence of KIR2DS2 +/KIR2DS5 +/KIR3DS1 + profile, increased number of stimulatory KIR genes and European and Amerindian ancestriesPMID:21233146
indicated nonspecific stimulation of natural killers, probably mediated by an increase in serum concentration of heat shock protein with a molecular weight of 70 kDaPMID:21165439
Observational study of gene-disease association. (HuGE Navigator)PMID:20878400
an evolutionary trend toward reducing the avidity of the activating C1- and C2-specific receptors is exempllified by KIR2DS2, an activating C1-specific receptor that has lost all detectable avidity for HLA class I.PMID:20802150
Observational study of gene-disease association. (HuGE Navigator)PMID:20528243
Observational study of gene-disease association. (HuGE Navigator)PMID:20580654
Observational study of gene-disease association. (HuGE Navigator)PMID:20600442
Observational study of gene-disease association. (HuGE Navigator)PMID:20643584
Observational study of genotype prevalence. (HuGE Navigator)PMID:20650299
Observational study of gene-disease association. (HuGE Navigator)PMID:20652381
Observational study of genotype prevalence. (HuGE Navigator)PMID:20670355
Observational study of gene-disease association. (HuGE Navigator)PMID:20137308
Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)PMID:20356536
Observational study of gene-disease association. (HuGE Navigator)PMID:20371502
Observational study of gene-disease association. (HuGE Navigator)PMID:20426625
Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)PMID:20483367
Observational study of gene-disease association. (HuGE Navigator)PMID:20492596
Observational study of gene-disease association. (HuGE Navigator)PMID:20519398
Single nucleotide polymorphism in KIR2DS2 gene is associated with posttransplantation non-Hodgkin lymphoma.PMID:20207982
Observational study of gene-disease association. (HuGE Navigator)PMID:19683555
Observational study of gene-disease association. (HuGE Navigator)PMID:19968064
Observational study of gene-disease association. (HuGE Navigator)PMID:20082482
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.