Recombinant Human Killer cell immunoglobulin-like receptor 2DL2 (KIR2DL2)

Code: CSB-CF012353HU
Size:
20μg
20μg100μg
US$4941
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
KIR2DL2
Uniprot NO.
Alternative Names
KIR2DL2; CD158B1; NKAT6; Killer cell immunoglobulin-like receptor 2DL2; CD158 antigen-like family member B1; MHC class I NK cell receptor; Natural killer-associated transcript 6; NKAT-6; p58 natural killer cell receptor clone CL-43; p58 NK receptor CL-43; CD antigen CD158b1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
22-348
Target Protein Sequence
HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.
Gene References into Functions
  1. Killer cell immunoglobulin like receptor two (KIR2DL2) shows a risk association with Chinese Han hepatitis C virus-1b (HCV-1b) patients not responding to the combination therapy of pegylated alpha interferon (PEG-IFN) with ribavirin (RBV). PMID:30039498
  2. KIR2DL2/HLA-C( *)12:02 and KIR2DL2/HLA-C( *)14:03 compound genotypes have protective effects on control of HIV-1. PMID:27880898
  3. KIR2DL2 gene polymorphism is associated with HIV-1 infection. PMID:26888639
  4. association between KIR2DS2 and the response to methotrexate (MTX), moreover, the combination KIR2DL2+/KIR2DS2+ was more frequent in responders to MTX (p = 0.043). PMID:27251940
  5. KIR2DL2/KIR2DL3-glutamate(35) alleles are functionally stronger than -glutamine(35) alleles. PMID:27030405
  6. KIR2DL2/2DS2-C1C1 genotype is associated with type 1 diabetes in Saudi children PMID:26542066
  7. genetic association study in population in Eastern India: Data suggest that interactions between KIRs (KIR2DL2, KIR2DS4, KIR2DL3) and HLA ligands (HLAC1, HLAC2) contribute significantly toward susceptibility and protection toward type 1 diabetes. PMID:26031759
  8. Allelic polymorphism of KIR2DL2/2DL3 in a southern Chinese population. PMID:26423800
  9. a significant increase in the frequency of KIR2DL2 (P = 0.019) as well as KIR2DS2 (P = 0.008) in patients with neuroblastoma compared with the healthy control group, was found. PMID:26202659
  10. Single Nucleotide Polymorphism in KIR2DL2 gene is associated with Asthma and Atopic Dermatitis. PMID:26430804
  11. genetic polymorphism is associated with chronic hepatitis C and levels of viremia in Poland PMID:25636579
  12. KIR2DL2 and KIR2DS2 genotype is associated with protection against primary biliary cirrhosis in Han population. PMID:25575065
  13. Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors. PMID:25329633
  14. Authors showed an increase in HLA-C1/KIR2DL2 and HLA-C1/KIR2DL3 pairs in human papillomavirus high-risk infected patients (OR 3.05, 3.24) with invasive cervical cancer (OR 1.33, 3.68). PMID:25188020
  15. KIR2DL3-positive NK cells were more sensitive to changes in the peptide content of MHC class I than KIR2DL2-positive NK cells. PMID:25359276
  16. Authors showed a significant increased correlation between KIR2DL2/DS2, type 2 diabetes and HLA-C1C1 genotype in the type 2 diabetes patients infected with human herpesvirus 8. PMID:24122895
  17. these results suggest that inhibitory KIR2DL2 and KIR2DL3, which are alleles of the same locus, play a role in the inverse effects on PM and PM/HIV co-infection PMID:22715396
  18. These data show that naturally occurring sequence variations within HLA-C03:04-restricted HIV-1 p24 Gag epitopes can have a significant impact on the binding of inhibitory KIR2DL2 receptors and primary natural killer cell function. PMID:24785948
  19. The strongest association for the development of epithelial ovarian cancer has been found between KIR2DL2 and HLA-C1 expression. PMID:24755350
  20. HLA-C genotypes are important determinants of conjunctival scarring in trachoma and that KIR2DL2/KIR2DL3 heterozygosity further increases risk of conjunctival scarring in individuals carrying HLA-C2. PMID:24651768
  21. combinations of KIR3DL1/HLA-Bw4, KIR2DL2/HLA-C1, and a genetic variant of the IL28B gene are predictive of the response to PEG-IFN and ribavirin therapy in Japanese patients infected with genotype 1b HCV. PMID:24349500
  22. The results of this study confirmed a possible effect of KIR2DL2 on viral infection susceptibility in multiple sclerosis patients. PMID:24735502
  23. Different expression levels of KIR2DL2 may contribute to the abnormal function of natural killer (NK) and NKT lymphocytes, which lead to the risk of systemic lupus erythematosus (SLE) susceptibility. PMID:24839813
  24. the most common KIR2DL2/3 allelic products in European American and African American populations were evaluated PMID:23686481
  25. Data indicate that increased frequency of the activating receptor KIR2DS1 and a reduced frequency of the KIR-ligand combination KIR2DS2/2DL2 absent/C1 present were significantly associated with chronic myeloid leukemia (CML). PMID:23380384
  26. presence of KIR2DL2 is associated with rheumatoid arthritis. PMID:22960345
  27. Engagement of KIR2DL2 might protect virus-infected cells from NK cell-mediated lysis and selections of sequence polymorphisms that increase avidity to KIR2DL2 might provide a mechanism for HIV-1 to escape NK cell-mediated immune pressure. PMID:22807681
  28. individuals possessing KIR2DL2 and/or KIR2DS2 (and, in most cases, also KIR2DL1) gene but no HLA-C C2 ligand may respond better to treatment and survive longer than people bearing other genotypes. PMID:22836042
  29. KIR2DS2/KIR2DL2 and HLA-C genotype of rheumatoid arthritis patients may provide predictive information for response to anti-TNF-alpha therapy. PMID:21373785
  30. The results are the first direct proof of the implication of KIR2DL2 receptor in the control of natural killer cell activation towards herpes virus infection in multiple sclerosis. PMID:22871633
  31. Amino acid variation at positions 68, 70, and 182 modulates the binding avidity of KIR2DL for histocompatibility antigen HLA-C compared to KIR2DL3. PMID:22772445
  32. In a comparison of healthy controls and a tightly defined cohort of adult ITP patients, the KIR2DS2/KIR2DL2 genotype was found to be associated with ITP independently of FCGR3a-158 polymorphisms. PMID:22024796
  33. in two unrelated viral infections, hepatitis C virus and human T lymphotropic virus type 1, possession of the KIR2DL2 gene enhanced both protective and detrimental HLA class I-restricted anti-viral immunity. PMID:22022261
  34. We report four novel KIR2DL2 alleles and two novel KIR2DL3 alleles identified from an East African population using sequence-based typing. PMID:20875478
  35. Single nucleotide polymorphism in KIR2DL2 gene is associated with posttransplantation non-Hodgkin lymphoma. PMID:20207982
  36. The KIR2DL2, KIR2DL3 genotype is predisposing to Crohn's disease in the presence of C1 ligand. PMID:19789864
  37. Absence of KIR2DS2 and/or KIR2DL2 is associated with failure of antiviral therapy in patients with recurrent hepatitis C after liver transplantation PMID:19877200
  38. Individuals were subgrouped according to the major HLA-C encoded KIR-epitopes (group C1 versus C2). C2 individuals transcribe RNA from KIR2DL2 genes without specific HLA-C ligands. PMID:12559621
  39. The genetic combination of KIR2DS2+ and KIR2DL2- is associated with scleroderma. PMID:15146426
  40. KIR2DL2 is positively associated with diabetes mellitus, type 1. PMID:15699512
  41. Because few factors interfere with the expression of CD158b on natural killer cells, monitoring of this marker may be accurate and sensitive after kidney transplantation. PMID:15848530
  42. KIRs on memory T cells operate to uncouple effector functions by modifying the transcriptional profile while leaving granule exocytosis unabated. PMID:16469873
  43. Lack of KIR2DL2 is associated with poor graft function PMID:17445184
  44. In contrast to natural killer (NK) cells, the functions of killer inhibitory receptors in CD4+ T lymphocytes might derive from a selective expression of their activating or inhibiting (CD158b1) forms. PMID:18292496
  45. Allelic polymorphism at sites distal to the ligand-binding site of KIR2DL2 has diversified this receptor's interactions with HLA-C; the interaction between the HLA-C epitope and KIR2DL2 strongly inhibits natural killer cell cytotoxicity. PMID:18322206
  46. Allele typing data support the view that KIR2DL2 and KIR2DL3 are alleles of the same gene. PMID:18498296
  47. increased frequency in recurrent spontaneous abortion group PMID:18572300
  48. The role of DNA methylation in regulating of the genes, KIR2DL2 and KIR2DL4, was characterized;these genes are normally suppressed in part by promoter methylation in non-expressing T cells. PMID:18945643
  49. a combination KIR2DL2- HLA-C1 plays a critical role in susceptibility or protection in Latvians against type 1 diabetes. PMID:19046302
  50. Natural killer (NK) cells in a humanized mouse model express multiple killer inhibitory receptors in a stochastic manner, including HLA-Cw3-specific inhibitory receptor KIR2DL2; these mice reject wild-type mouse spleen cells upon intravenous injection. PMID:19234149

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Database Links

HGNC: 6330

UNIGENE: Hs.743949

KEGG: hsa:3803

OMIM: 604937

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products