MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for metastin (kisspeptin-54 or kp-54), a C-terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein that suppresses metastases in malignant melanomas and in some breast carcinomas without affecting tumorigenicity. The metastasis suppressor properties may be mediated in part by cell cycle arrest and induction of apoptosis in malignant cells. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. The receptor is also probably involved in the regulation and fine-tuning of trophoblast invasion generated by the trophoblast itself. Analysis of the transduction pathways activated by the receptor identifies coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins.
Gene References into Functions
The study shows that KISS1R mutants are responsible for the normosmic congenital hypogonadotrophic hypogonadism phenotype in only a small minority of casesPMID:27094476
Kisspeptin-10 may contribute to accelerate the progression and instability of atheromatous plaques, leading to plaque rupture. The GPR54 antagonist may be useful for prevention and treatment of atherosclerosis.PMID:28411243
The missense variant (c.1091Tgt;A) was a nonsynonymous polymorphism that induces amino acid substitution of p.Leu364His. The haplotype CAGTGTC was detected more frequently in the central precocious puberty group.PMID:27914139
Metabolism and Energy Expenditure, But Not Feeding or Glucose Tolerance, Are Impaired in Young Kiss1r KO Female MicePMID:27649089
Neuropeptide derivatives to regulate the reproductive axis: Kisspeptin receptor (KISS1R) ligands and neurokinin-3 receptor (NK3R) ligands.PMID:27271543
In human cumulus GCs, kiss1r mRNA levels were positively correlated with age but not with BMI. There was no expression of kiss1 mRNA in either cumulus or mural GCsPMID:26879207
KISS1R signaling induces invadopodia formation and activation of key invadopodia proteins, cortactin, cofilin and membrane type I matrix metalloproteases (MT1-MMP).PMID:26721186
KISS1R Low Expression Correlates with Colorectal Liver Metastasis.PMID:26471489
KiSS1 is a metastasis suppressor gene of pancreatic cancer, and this suppression is not dependent on the expression levels of GPR54.PMID:26572251
confirmed that mutations in KISS1 and KISS1R are not a common cause for ICPPPMID:23950571
Two novel heterozygous missense mutations in FGFR1 and one novel heterozygous missense mutation in KISS1R, were identified in in Chinese Kallmann Syndrome Males with Cleft Lip/Palate.PMID:26199944
The majority of human non-functioning pituitary tumors expressed KISS1R with lower rates of expression in other types of pituitary tumors.PMID:24817066
The promoter of GPR54 is unmethylated in normal endometriumPMID:24908069
Present data do not confirm the protective role of KiSS1/KiSS1R in breast cancer progression, but our results do support the hypothesis that KiSS1/KiSS1R system is activated even in primary breast cancer and sustained during invasion to local lymph nodes.PMID:25535062
Normosmic idiopathic hypogonadotropic hypogonadism due to a novel homozygous nonsense c.C969A (p.Y323X) mutation in the KISS1R gene in three unrelated families.PMID:25262569
A number of mutations in KISS1 KISS1R are associated with central precocious puberty and isolated hypogonadotropic hypogonadism. (Review)PMID:26510589
No KISS1R expression was detected in normal or malignant tissues or in liver metastases.PMID:26010933
Reduction of Kiss-1R expression is linked to poor prognosis for colorectal cancer patients.PMID:25260785
Decreased expression of KISS1R seems to attenuate signaling of the KISS1/KISS1R system, possibly leading to tumor growthPMID:25667462
data indicate that GPR54 and TACR3 gene mutations are not a frequent cause of ICPP. The identified A/G synonymous SNP (dbSNP ID: rs10407968) located in exon 1 of the gene is not likely to have a pathogenic role in exon splicingPMID:24434351
Kisspeptin, GPR54 and PIBF expressions in syncytiotrophoblasts and cytotrophoblasts were decreased in recurrent spontaneous abortion women as compared to controlsPMID:24225150
Sustained calcium response to kisspeptin is dependent on the continued presence of extracellular ligand and is the result of dynamic KISS1R trafficking.PMID:24295737
High GPR54 expression is associated with breast cancer.PMID:24596387
The downregulation of Kiss-1 has been shown to correlate with decreased Kiss-1R expression, which is inversely associated with clinical stage and tumour grade. [Review]PMID:23969598
cumulative survival rate of patients with KISS1 or KISS1R expression was significantly higher compared to that without expression. KISS1 or KISS1R expression in non-small cell lung cancer can be used to indicate favorable prognosis for disease outcome.PMID:23716269
The additiona of a PRR repeat into a proline-arginine-rich motif can dramatically change the conformation of the intracellular domain of KISS1R and its probable interaction with partner proteins.PMID:23608644
Data show that that the expression of Kiss1 Kiss1R and MMP9 were higher in the placenta compared to the placental bed and decidua parietalis.PMID:23696833
mutations with confirmed association with idiopathic central precocious puberty were identified in kisspeptin and KISS1R. These observations underscore the role of KISS1R signaling for normal pubertal development.PMID:23550005
Structure, synthesis, and phylogeny of kisspeptin and its receptor.PMID:23550000
Both sets of neurons project to GnRH cell bodies, which contain Kiss1r, and the ARC kisspeptin population also projects to GnRH axons in the median eminence.PMID:23550001
Data suggest that the ERalpha status of mammary cells dictates whether KISS1R may be a novel clinical target for treating breast cancer metastasis.PMID:23525242
Data show that a loss-of-function mutation (p.Tyr313His) in the KISS1R gene can cause familial congenital hypogonadotropic hypogonadism (nCHH), revealing the crucial role of this amino acid in KISS1R functionPMID:23349759
study suggests that negative expression of metastin receptor in clear cell RCC is significantly related to metastasisPMID:23277422
Negative fetal FSH/LH regulation in late pregnancy is associated with declined kisspeptin/KISS1R expression in the tuberal hypothalamus.PMID:23015653
KISS1R-expressing cells undergo sustained kisspeptin-induced signaling that is dependent upon an influx of extracellular Ca2+PMID:23070548
The subnormal gonadal response to hCG in patients may implicate a direct role of KISS1R in gonadal function and fetal development of male external genitalia.PMID:22619348
Results suggest that findings of increased kisspeptin receptor (KISS1R) expression may represent a mechanism by which functional activity of kisspeptin (KISS1) is higher in pre-eclampsia (PE) than in normal pregnancy.PMID:22526494
NKB/NK(3)R and kisspeptin/KISS1R are present in female peripheral reproductive tissues with colocalization of both systems in some non-neuronal cell populations of the human female genital tract.PMID:22424618
Data suggest that the KISS1/KISS1R system may play a role in the pathophysiology of endometriosis only for a particular group of patients.PMID:22210725
Compared to Kiss-1 protein, GPR54 expression was mainly present in syncytiotrophoblasts and deciduas, but not in cytotrophoblasts of women with recurrent pregnancy loss.PMID:21996032
Kisspeptin and its receptor are expressed in the human, rat and mouse heart and kisspeptins possess potent positive inotropic activity.PMID:22132116
Studies indicate that KISS1R is degraded by the proteasome, as opposed to the classic lysosomal degradation described for most G protein-coupled receptors.PMID:21912371
KISS1 and KISS1R expression in the human and rat carotid body and superior cervical ganglion.PMID:22193294
Data show that endometrial cancer overall survival is improved with high expression of GPR54 and that GPR54 expression is associated with known prognostic factors.PMID:21282360
This chapter describes the kisspeptin-GPR54 complex physiology and its current role in human diseases.PMID:20374724
A novel loss-of-function mutation in the GPR54 gene is associated with familial normosmic idiopathic hypogonadotropic hypogonadismPMID:21193544
The Arg386Pro mutation does not affect the rate of KISS1R trafficking--instead, it prolongs responsiveness to kisspeptin by decreasing KISS1R degradation, resulting in the net increase on mutant receptor recycled back to the plasma membrane.PMID:21285314
Results provide primary evidence that KISS1 and KISS1R expression can be differentially lost in pituitary tumor subtypes.PMID:21169415
One novel homozygous KISS1R mutation was identified in two siblings with normosmic isolated hypogonadotropic hypogonadism.PMID:20371656
Inactivating mutations of the KISS1 receptor cause isolated hypogonadotropic hypogonadism.PMID:20237166
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Most highly expressed in the pancreas, placenta and spinal cord, with lower-level of expression in peripheral blood leukocytes, kidney, lung, fetal liver, stomach, small intestine, testes, spleen, thymus, adrenal glands and lymph nodes. In the adult brain