MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV RNTVQDPAYLRDIDGMNKPV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins. Also functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions.
Gene References into Functions
The OPRK1 gene variants showed significant association with susceptibility to opioid dependence among Iranians.PMID:28786760
Down-regulation of KOR in HCC tumour tissues has a strong association with poor prognosis and KOR might be a potential tumour suppressor.PMID:28821282
In HUVEC cells subjected to artificial hyperlipidemia, selective agonists and antagonists showed that kappa-opioid receptor stimulation normalizes endothelial ultrastructure and function under hyperlipidemic conditions via the PI3K/Akt/eNOS pathway.PMID:27226238
The OPRK1/kappa-opioid receptor pathway was found to be downregulated in lesional skin of psoriasis, correlating positively with itch sensation.PMID:27958613
These results indicate that KOR can form a heterodimer with B2R and this leads to increased protein kinase A activity by the CREB signaling pathway, leading to a significant increase in cell proliferation.PMID:28069442
that promoter fragments of OPRK1 and OPRM1 were able to upregulate gene expression with mild cognitive impairmentPMID:27838450
Hypoxia inducible factor-1alpha (HIF-1alpha) siRNA knocked down the increase of endogenous HIF-1alpha messages and diminished the desferrioxamine (DFO)-induced increase of kappa-opioid receptor (hKOR) expression.PMID:28117678
genetic association studies in a population in Denmark: Data suggest that carriers/heterozygotes of the C allele (CC/CT) of OPRK SNP rs6473799 report a 30.4% higher mechanical visceral pain tolerance threshold than non-carriers.PMID:27061127
Molecular switches of the kappa opioid receptor triggered by 6'-GNTI and 5'-GNTI have been described.PMID:26742690
data provide evidence for genetic modulation of opioid withdrawal severity.PMID:26692286
OPRK1 promoter hypermethylation might increase the risk of AD through its regulation on the gene expression of OPRK1.PMID:26300544
OX1R and KOR heterodimerize, and this heterodimer associates with Galphas, leading to increased protein kinase A (PKA) signaling pathway activity, including upregulation of intracellular cAMP levels.PMID:25866368
The structure of the dynorphin (1-13) peptide (dynorphin) bound to the human kappa opioid receptor (KOR) has been determined by liquid-state NMR spectroscopy.PMID:26372966
RGS2 and RGS4 are new interacting partners that play key roles in G protein coupling to negatively regulate kappa-OmicronR signaling.PMID:25289860
Data show that the crystallographic structures of the mouse mu-opioid receptor (MOPr) and human kappa-opioid receptor (KOPr) indicate putative interfacial interactions.PMID:24651466
Here we describe three experimental procedures we used to evaluate the interaction between hKOPR and 14-3-3zeta: co-immunoprecipitation, pull-down assay and immunofluorescence microscopy.PMID:25293321
Studied differential DNA-protein interactions of PDYN and OPRK1 SNPs significantly associated with alcohol dependence.PMID:25177835
Results suggest that Kappa receptor availability in an amygdala-cingulate cortex-striatal circuit mediates the phenotypic expression of trauma-related loss (ie, dysphoria) symptoms.PMID:25229257
Low OPRK1 expression is associated with liver metastases of small bowel neuroendocrine tumors.PMID:25241033
Data indicate that replacement of the 3-hydroxyl substituent of the 4-(3-hydroxyphenyl) group of JDTic with a H, F, or Cl substituent leads to potent and selective kappa opioid receptor (KOR) antagonists.PMID:25133923
findings suggest that genetic polymorphisms in OPRK1 were associated with the body weight, alcohol use, and opioid withdrawal symptoms in MMT patients.PMID:24525640
Suggest that methamphetamine induced early autophagic response is a survival mechanism for apoptotic endothelial cells and is mediated through the kappa opioid receptor.PMID:24603327
In heroin-dependent patients, no difference was evidenced between responders and non-reponders to buprenorphine therapy in the frequency of OPRK1 SNP.PMID:24274990
Neurocognitive and neuroinflammatory correlates of OPRK1 mRNA expression in the anterior cingulate in postmortem brain of HIV-infected subjects.PMID:24405578
This study indicates that a patient's OPRK1 genotype could be used to identify a subset of individuals for whom vaccine treatment may be an effective pharmacotherapy for cocaine dependence.PMID:23995774
OPRK1 rs6989250 C>G is associated with stress-induced craving and cortisol, hyperactive hypothalamus/thalamus-midbrain-cerebellum responses, and also associated with greater subsequent cocaine relapse risk.PMID:23962922
Data suggest that dynorphin A (DynA) is ligand for opioid receptor kappa (KOR); upon DynA binding, only small chemical shifts observed in second extracellular loop of KOR; chemical shift changes of DynA show conclusively that DynA interacts with KOR.PMID:24616919
crystal structure provides fundamental insights into the activation mechanism of the kappa-opioid receptor and suggest that "functional" residues may be directly involved in transduction of the agonist binding eventPMID:24121503
Kappa Opioid receptor in the nucleus is a novel prognostic factor of esophageal squamous cell carcinoma.PMID:23574786
OPRK1 and PDYN polymorphisms may alter severity of HIV infection and response to treatment.PMID:23392455
Pairwise tag single nucleotide polymorphisms (SNPs) in DREAM, PDYN and OPRK1 were genotyped in a United Kingdom population-based discovery cohort in whom pain was assessed.PMID:22730276
hKOR activates p38 MAPK through a phosphorylation and arrestin-dependent mechanism; however, activation differs between hKOR and rKOR for some ligandsPMID:23086943
Data indicate that 14-3-3zeta interaction with kappa-opioid receptor (hKOPR) C-tail promotes export of hKOPR.PMID:22989890
A role is estsablished for dynorphin kappa-opioid receptor signaling in fear extinction.PMID:22764240
crystal structure of the human kappa-OR in complex with the selective antagonist JDTic, arranged in parallel dimers, at 2.9 A resolutionPMID:22437504
Human apelin forms a heterodimer with the kappa opioid receptor and leads to increased protein kinase C and decreased protein kinase A.PMID:22200678
In summary, this study provides evidence that gene-gene interaction between KOR and OPRM1 can influence the risk of addiction to narcotics and alcohol.PMID:22138325
These findings provide evidence that previously demonstrated KOR-mediated reduction in intraocular pressure could be caused, in part, by NO production in both the ciliary body and the trabecular meshwork.PMID:21666232
This is the first report detailing the initiation of a KOR-induced JAK2/STAT3 and IRF2 signaling cascade, and these pathways result in substantial down-regulation of CXCR4 expression.PMID:21447649
because of its stronger binding for hKOPR, GEC1 is able to be recruited by hKOPR sufficiently without membrane association via its C-terminal modification; however, du GABARAP appears to require C-terminal modifications to enhance KOPR expression.PMID:21388957
Review. kappa-Opioid receptor signaling and brain reward function.PMID:19804796
phosphorylation of serine 369 mediates KOR desensitization and internalizationPMID:12815037
binding of the KOR to NHERF-1/EBP50 facilitates oligomerization of NHERF-1/EBP50, leading to stimulation of NHE3.PMID:15070904
OPKR1 structure and association of haplotypes with opiate addiction was found to have empirical significance.PMID:15608558
The diterpenoid salvinorin A utilizes unique residues within a commonly shared binding pocket to selectively activate KORs.PMID:15952771
GEC1 interacts with the kappa opioid receptor and enhances expression of the receptorPMID:16431922
Family-based analyses demonstrated associations between alcohol dependence and multiple SNPs in intron 2 of OPRK1.PMID:16924269
Helical orientation of helix 2 are critical for the selectivity of salvinorin A binding to KOR and provide a structurally novel basis for ligand selectivity.PMID:17121830
frequency of KOR 36G > T SNP was significantly higher among heroin-dependent individuals compared with control subjectsPMID:17373729
activation of KORs alters functional properties of neural precursor cells that are relevant to human brain development and repair.PMID:17538007