IFITM2; Interferon-induced transmembrane protein 2; Dispanin subfamily A member 2c; DSPA2c; Interferon-inducible protein 1-8D
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-132
Target Protein Sequence
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWS LFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILL IIIPVLVVQAQR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), hepatitis C virus (HCV) and vesicular stomatitis virus (VSV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV and SARS-CoV-2 S protein-mediated viral entry and VSV G protein-mediated viral entry. Induces cell cycle arrest and mediates apoptosis by caspase activation and in p53-independent manner. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation. IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome.
Gene References into Functions
Delta20 IFITM2 may serve as a major contributor to the gatekeeping mechanism that explains restriction of X4 viruses in the early stage of HIV-1 infectionPMID:28630320
These results indicate that IFITM2 protein can restrict alphavirus infection by inhibiting viral fusion with cellular membranes.PMID:27219333
IFITM2 promotes gastric cancer growth and metastasis via IGF1/IGF1R/STAT3 signaling pathway.PMID:28223169
Single Nucleotide Polymorphisms in 1-8D is associated with neoplasms.PMID:19544527
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Lysosome membrane; Single-pass type II membrane protein. Late endosome membrane; Single-pass type II membrane protein.