MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of agonist). Agonist stimulation of isoform 3 neither modified adenylate cyclase activity nor induced intracellular calcium mobilization.
Gene References into Functions
These results indicate that in SH-SY5Y cells, hH3R445 and hH3R365 isoforms regulate in a differential manner the signaling pathways triggered by receptor activation.PMID:29557708
results indicate that the single-point Y197C mutation, in the aminus region of TM5 of the hH3R445, does not affect the expression, ligand binding or signaling of the receptorPMID:28126588
We detected high H3R expression in oligodendroglial cells from demyelination lesions in human samples of patients with MS, and validated a genetic association between an exonic single nucleotide polymorphism in HRH3 and susceptibility to multiple sclerosis.PMID:29253893
These findings for the first time screen out one SNP (rs3787429) of HRH3 gene that was significantly associated with CHF in Chinese Han populationPMID:26989676
Decrease in histamine H3 receptor function was linked to epileptic activity in the hippocampus and temporal neocortex of patients with pharmacoresistant mesial temporal lobe epilepsy.PMID:26915454
Molecular modelling studies, including molecular dynamic simulations and calculation of Gibbs energy of solvation of hH3R and hH4R, were studied.PMID:25098339
The polymorphisms of HNMT and HRH3 were irrelevant with breast cancer in the present study.PMID:24835231
the anatomical localization of Hreceptors suggests a complex interaction that could both enhance and inhibit dopaminergic neurotransmission; tt is conceivable that Hreceptors can moderate the development and maintenance of drug addiction.PMID:23647606
The A280V mutation reduces the signalling efficacy of the human H3 receptor; this effect may be relevant to the pathophysiology of disorders associated with the mutationPMID:23713487
Report synthesis/functional characterization of imbutamine analogs as histamine H3 agonists.PMID:24493592
In this review, we focus on the role of histamine and its receptors in the treatment of Alzheimer's disease.PMID:23677734
[review] The H1, H2, and H3 receptors are all involved in recovery of neurological function when extracellular histamine is gradually increasing, after cerebral ischemia.PMID:22860191
mRNA expression of HRH-3 localized in large pigmented neurons is significantly decreased in the substantia nigra of Parkinson's patients.PMID:22118942
ZEL-H16 is a novel and potent nonimidazole agonist of H3R, which might serve as a pharmacological tool for future investigations or as possible therapeutic agent of H3R.PMID:22870296
Significant association of HRH3 with antipsychotic efficacy was detected.PMID:21652606
study identified novel functional properties in terms of voltage sensitivities and deactivation rates, which differed between the histamine hH3445, hH3365, and H4 receptorsPMID:22885137
Histamine H3 receptor levels are unchanged in subcortical ischemic vascular dementia and mixed dementias in all brain areas studied.PMID:22129936
The hydrophobic amino acids in putative helix 8 in carboxy-terminus of histamine H(3) receptor are involved in receptor-G-protein coupling.PMID:21749919
Data suggest that V-allele genotypes in the H3 receptor gene increase inactive receptors, enhancing inhibition of negative feedback mechanism on the H3 receptor and increasing histamine release, correlating with migraine attacks in susceptible patients.PMID:21376262
This review outlines the relevance of the histaminergic system in controlling feeding behavior and evaluates the potential role of the histamine H3 receptor as a target for regulating obesity.PMID:20864503
Modulation of PKCalpha by histamine receptors may be important in regulating cholangiocarcinoma growth.PMID:19825989
Analogous to the effects of alpha(2)-adrenoceptors, which also act prejunctionally to inhibit norepinephrine release, H(3)R-mediated antiexocytotic effects could result from a decreased Ca(2+) influx into nerve endingsPMID:11752397
The structure of HRH3 has been determined and a missense mutation (Ala280Val) identified in a patient with Shy-Drager syndrome.PMID:11956964
Molecular cloning of functionally distinct isoforms of the human histamine H(3) receptorPMID:12069903
Densities of histamine H(3) receptor sites were significantly decreased in patient material.PMID:12971961
absence of H3 receptor in human skin mast cellsPMID:15191551
The human H(3)receptor gene suggested to consist of either 3 exons and 2 introns, or 4 exons and 3 introns, with ...additional exon accounting for...8 additional carboxy(C)-terminal amino acids...in some human H(3) receptor sequencesPMID:15665857
we describe the biological and chemical implications for developing H3 receptor antagonists and their therapeutic potential as disclosed through animal models of cognition, sleep, and obesity.PMID:16565470
The purpose of this study was to identify the structural requirements for H3 antagonistic activity via quantitative structure-activity relationship (QSAR) studies and receptor modeling/docking techniques.PMID:17561422
Histamine excites human enteric neurones and this effect involves histamine H1-4 receptors.PMID:17627982
Data show that histamine regulates pancreatic carcinoma cell growth through H3 and H4 receptors.PMID:18345506
H(3)R is localized mainly around submucosal glands and plays an important role in the secretion of submucosal glands in the nose.PMID:18564330
D1-H3 receptor heteromers constitute unique devices that can direct dopaminergic and histaminergic signalling towards the MAPK pathway in a G(s)-independent and G(i)-dependent manner.PMID:19413572
Histamine H3 receptors in the prefrontal cortex take part in the modulation of cognition, which is impaired in schizophrenic subjects and bipolar subjects with psychotic symptoms.PMID:19413576
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed predominantly in the CNS, with the greatest expression in the thalamus and caudate nucleus. The various isoforms are mainly coexpressed in brain, but their relative expression level varies in a region-specific manner. Isoform 3 and isoform 7 are