Recombinant Human Histamine H3 receptor (HRH3)

Code: CSB-CF897568HU
Size:
20μg
20μg100μg
US$5824
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
HRH3
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-445
Target Protein Sequence
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
The H3 subclass of histamine receptors could mediate the histamine signals in CNS and peripheral nervous system. Signals through the inhibition of adenylate cyclase and displays high constitutive activity (spontaneous activity in the absence of agonist). Agonist stimulation of isoform 3 neither modified adenylate cyclase activity nor induced intracellular calcium mobilization.
Gene References into Functions
  1. These results indicate that in SH-SY5Y cells, hH3R445 and hH3R365 isoforms regulate in a differential manner the signaling pathways triggered by receptor activation. PMID:29557708
  2. results indicate that the single-point Y197C mutation, in the aminus region of TM5 of the hH3R445, does not affect the expression, ligand binding or signaling of the receptor PMID:28126588
  3. We detected high H3R expression in oligodendroglial cells from demyelination lesions in human samples of patients with MS, and validated a genetic association between an exonic single nucleotide polymorphism in HRH3 and susceptibility to multiple sclerosis. PMID:29253893
  4. These findings for the first time screen out one SNP (rs3787429) of HRH3 gene that was significantly associated with CHF in Chinese Han population PMID:26989676
  5. Decrease in histamine H3 receptor function was linked to epileptic activity in the hippocampus and temporal neocortex of patients with pharmacoresistant mesial temporal lobe epilepsy. PMID:26915454
  6. Molecular modelling studies, including molecular dynamic simulations and calculation of Gibbs energy of solvation of hH3R and hH4R, were studied. PMID:25098339
  7. The polymorphisms of HNMT and HRH3 were irrelevant with breast cancer in the present study. PMID:24835231
  8. the anatomical localization of Hreceptors suggests a complex interaction that could both enhance and inhibit dopaminergic neurotransmission; tt is conceivable that Hreceptors can moderate the development and maintenance of drug addiction. PMID:23647606
  9. The A280V mutation reduces the signalling efficacy of the human H3 receptor; this effect may be relevant to the pathophysiology of disorders associated with the mutation PMID:23713487
  10. Report synthesis/functional characterization of imbutamine analogs as histamine H3 agonists. PMID:24493592
  11. In this review, we focus on the role of histamine and its receptors in the treatment of Alzheimer's disease. PMID:23677734
  12. [review] The H1, H2, and H3 receptors are all involved in recovery of neurological function when extracellular histamine is gradually increasing, after cerebral ischemia. PMID:22860191
  13. mRNA expression of HRH-3 localized in large pigmented neurons is significantly decreased in the substantia nigra of Parkinson's patients. PMID:22118942
  14. ZEL-H16 is a novel and potent nonimidazole agonist of H3R, which might serve as a pharmacological tool for future investigations or as possible therapeutic agent of H3R. PMID:22870296
  15. Significant association of HRH3 with antipsychotic efficacy was detected. PMID:21652606
  16. study identified novel functional properties in terms of voltage sensitivities and deactivation rates, which differed between the histamine hH3445, hH3365, and H4 receptors PMID:22885137
  17. Histamine H3 receptor levels are unchanged in subcortical ischemic vascular dementia and mixed dementias in all brain areas studied. PMID:22129936
  18. The hydrophobic amino acids in putative helix 8 in carboxy-terminus of histamine H(3) receptor are involved in receptor-G-protein coupling. PMID:21749919
  19. Data suggest that V-allele genotypes in the H3 receptor gene increase inactive receptors, enhancing inhibition of negative feedback mechanism on the H3 receptor and increasing histamine release, correlating with migraine attacks in susceptible patients. PMID:21376262
  20. This review outlines the relevance of the histaminergic system in controlling feeding behavior and evaluates the potential role of the histamine H3 receptor as a target for regulating obesity. PMID:20864503
  21. Modulation of PKCalpha by histamine receptors may be important in regulating cholangiocarcinoma growth. PMID:19825989
  22. Analogous to the effects of alpha(2)-adrenoceptors, which also act prejunctionally to inhibit norepinephrine release, H(3)R-mediated antiexocytotic effects could result from a decreased Ca(2+) influx into nerve endings PMID:11752397
  23. The structure of HRH3 has been determined and a missense mutation (Ala280Val) identified in a patient with Shy-Drager syndrome. PMID:11956964
  24. Molecular cloning of functionally distinct isoforms of the human histamine H(3) receptor PMID:12069903
  25. Densities of histamine H(3) receptor sites were significantly decreased in patient material. PMID:12971961
  26. absence of H3 receptor in human skin mast cells PMID:15191551
  27. The human H(3)receptor gene suggested to consist of either 3 exons and 2 introns, or 4 exons and 3 introns, with ...additional exon accounting for...8 additional carboxy(C)-terminal amino acids...in some human H(3) receptor sequences PMID:15665857
  28. we describe the biological and chemical implications for developing H3 receptor antagonists and their therapeutic potential as disclosed through animal models of cognition, sleep, and obesity. PMID:16565470
  29. The purpose of this study was to identify the structural requirements for H3 antagonistic activity via quantitative structure-activity relationship (QSAR) studies and receptor modeling/docking techniques. PMID:17561422
  30. Histamine excites human enteric neurones and this effect involves histamine H1-4 receptors. PMID:17627982
  31. Data show that histamine regulates pancreatic carcinoma cell growth through H3 and H4 receptors. PMID:18345506
  32. H(3)R is localized mainly around submucosal glands and plays an important role in the secretion of submucosal glands in the nose. PMID:18564330
  33. role in neurogenic inflammation PMID:18802338
  34. D1-H3 receptor heteromers constitute unique devices that can direct dopaminergic and histaminergic signalling towards the MAPK pathway in a G(s)-independent and G(i)-dependent manner. PMID:19413572
  35. Histamine H3 receptors in the prefrontal cortex take part in the modulation of cognition, which is impaired in schizophrenic subjects and bipolar subjects with psychotic symptoms. PMID:19413576

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed predominantly in the CNS, with the greatest expression in the thalamus and caudate nucleus. The various isoforms are mainly coexpressed in brain, but their relative expression level varies in a region-specific manner. Isoform 3 and isoform 7 are
Database Links

HGNC: 5184

UNIGENE: Hs.251399

KEGG: hsa:11255

STRING: 9606.ENSP00000342560

OMIM: 604525

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products