HLA-DPA1; HLA-DP1A; HLASBHLA class II histocompatibility antigen; DP alpha 1 chain; DP(W3); DP(W4); HLA-SB alpha chain; MHC class II DP3-alpha; MHC class II DPA1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
29-260
Target Protein Sequence
AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading.
Gene References into Functions
HLA-DPA1 and HLA-DPB1 variants can determine susceptibility or protective effect against Hepatitis B virus infection in an Indonesian population.PMID:27051043
The HLA-B*42, HLA-C*17, HLA-DPA1*03, and HLA-DPB1*105 genotypes were associated with allergic asthma and the HLA-B*48 genotype with the nonallergic phenotype. The presence of the haplotype HLA-DPA1*03 DQA*05 was associated with allergic asthma, and the presence of HLA-DPA1*03 and the absence of HLA-DQA*05 with nonallergic asthma.PMID:28380482
Single-nucleotide polymorphism in HLA-DPA1 gene is associated with sclerotic graft-versus-host disease.PMID:27313329
Single-nucleotide polymorphism in HLA-DP is associated with cervical cancer susceptibility.PMID:26711785
rs3077 in HLA-DPA1 is a significantly associated SNP associated with chronic hepatitis B virus infection and viral clearance.PMID:24846544
This resource provides population estimates of the frequencies of HLA alleles at these eight loci in the three population groups, particularly for HLA-DPA1 and HLA-DPB1 that were not assayed in HapMap.PMID:24698974
DPA1*02:01- DPB1*14:01 and DPA1*02:01- DPB1*17:01 haplotypes provide considerable protection effect against Posner-Schlossman syndrome.PMID:25863099
HLA-DP gene polymorphisms are strongly associated with chronic hepatitis B virus infection.PMID:25449085
The study suggests that HLA-DPA1/B1 loci are candidate susceptibility regions that have some marker single nucleotide polymorphisms for both chronic hepatitis C virus infection and F protein generation in the Han Chinese population.PMID:24897020
Single nucleotide polymorphisms rs3077 and rs9277378 in HLA-DPA1 and HLA-DPB1 are significantly associated with protective effects against chronic hepatitis B.PMID:24465836
It related to persistence of hepatitis B virus (HBV) infection and viral load in chronic HBV.PMID:23980639
HLA-DPA1 and DPB1 allele frequencies and haplotypes of the population of Guadeloupe were most similar to African populations, with characteristic alleles and haplotypes that bespeaks the admixture with other ethnicities.PMID:24405442
Crystal structure of the extracellular region of the HLA-DPA1/DPB1 heterodimer, in complex with the major antigenic peptide from the Japanese cedar pollen allergen.PMID:25020231
Data indicate that CD4+ T cell allorecognition of HLA-DP is significantly affected by DPA1 polymorphism.PMID:24462895
Studied three HLA-DP and IL28B SNPs of CHB patients with and without spontaneous HBsAg seroclearance.Haplotype analysis of HLA-DP polymorphisms showed association with HBsAg seroclearance.PMID:23449268
HLA-DP SNPs rs3077, rs9277378 and rs3128917 were associated with chronicity of HBV disease in the ChinesePMID:23825586
HLA-DP polymorphisms affect affect genotype B hepatitis B virus clearance, regulate immune selection of viral mutations, and influence cirrhosis and hepatocellular carcinoma risks contributed by hepatitis B virus mutationsPMID:24006435
This is the first study that confirms the association of HLA markers and haplotypes around HLA-DPA1 and HLA-DPB1 with ankylosing spondylitis.PMID:23459078
Data indicate that comparing to GG haplotype of rs3077 (near HLA-DPA1 region) and rs9277535 (near HLA-DPB1 region), GA haplotype had a higher chance of achieving spontaneous HBsAg loss.PMID:23326374
Significant associations of HLA-DP rs3077 and rs9277535 with increased risks of cervical cancer in a Chinese population were found.PMID:23428460
HLA-DPA1 genetic variation, proxies for early life immune modulation and childhood acute lymphoblastic leukemia.PMID:22923493
HLA-DP has a role in protection against chronic hepatitis B and viral clearance in Japanese and KoreansPMID:22737229
HLA-DPA1 variant is associated with hepatitis B virus infection.PMID:22448225
A novel variant in the HLA-DPB1 3'UTR region, 496A/G, is associated significantly with HBV recovery in European and African-American populations.PMID:22496224
Genetic variants of the HLA-DP genes are risk factors for the development of hepatocellular carcinoma in chinese patients.PMID:22105689
variants previously associated with chronic hepatitis B are also strongly associated with mRNA expression of HLA-DPA1 and HLA-DPB1, suggesting that expression of these genes is important in control of HBV.PMID:21346778
genetic variants in the HLA-DPA1 and HLA-DPB1 locus are associated with the risk of pediatric asthma in Asian populations.PMID:21814517
HLA - DPA1 rs3077 T was strongly associated with decreased risk of chronic hepatitis B virus infection (odds ratio, .62; P = .001), consistent with the previous report.PMID:21402545
Genetic variants in the HLA-DP locus are strongly associated with persistent chronic hepatitis B virus infection in the Han Chinese population.PMID:21274863
DPA1*020107 was identified from a woman of Ugandan origin by a taxonomy-based sequence analysis of human leukocyte antigen DPA1. It is identical to DPA1*020101 with the exception of a single nucleotide synonymous substitution at codon 58 (GGC-->GGT).PMID:20470845
HLA-DPA1 allelic and haplotypic diversity contributes significantly to the risk for type 1 diabetesPMID:20424227
HLA-DPA1 promoter haplotypes are differently distributed in southern Chinese ethnic groupsPMID:15713216
Our findings show that genetic variants in the HLA-DPA1 locus are strongly associated with risk of persistent infection with hepatitis B virus.PMID:19349983
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note=The MHC class II complex transits through a number of intracellular compartments in the endocytic pathway until it reaches the cell membrane for antigen presentation.