Home
Product
Protein
Transmembrane Proteins
Recombinant Human HERV-H LTR-associating protein 2 (HHLA2)

Recombinant Human HERV-H LTR-associating protein 2 (HHLA2)

Code: CSB-CF891555HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5428

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

HHLA2

Uniprot NO.

Q9UM44

Alternative Names

HHLA2; HERV-H LTR-associating protein 2; Human endogenous retrovirus-H long terminal repeat-associating protein 2

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

23-414

Target Protein Sequence

IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLE SQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFL TPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNIT GSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSR MKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSD EYTLLTIHTVHVEPSQETASHNKGLWILVPSAILAAFLLIWSVKCCRAQLEARRSRHPAD GAQQERCCVPPGERCPSAPDNGEENVPLSGKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Through interaction with TMIGD2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.

Gene References into Functions

HHLA2 protein expression was evaluated in primary tumor specimens and metastatic disease using an osteosarcoma tumor microarray. HHLA2 was expressed in almost all metastatic disease specimens and was more prevalent than in primary specimens without known metastases. PMID:27531281
HHLA2 was not detected in most of normal lung tissue but expressed in 66% of NSCLC across different subtypes. In particular, EGFR-mutated NSCLC was significantly associated with higher tumor HHLA2 expression in both discovery and validation lung cancer cohorts. HHLA2 is widely expressed in NSCLC and is associated with EGFR mutation and high TILs in lung adenocarcinoma. PMID:27553831
Low B7-H5 expression is associated with pancreatic adenocarcinomas. PMID:25519928
The HHLA2 pathway represents a novel immunosuppressive mechanism within the tumor microenvironment. PMID:25549724
B7 homologue 5 (B7-H5), was identified as a specific ligand for CD28H PMID:23784006
Data indicate that HHLA2 protein was predominantly found on cell membranes with some in the cytoplasm. PMID:23716685

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Tissue Specificity

Expressed at high levels in colon, kidney, testis, lung and pancreas, and at lower levels in small intestine, liver and skeletal muscle. In immune cells, highly expressed in B-cells, dendritic cells and macrophages. Not detected in T-cells.

Database Links

HGNC: 4905

UNIGENE: Hs.225968

KEGG: hsa:11148

STRING: 9606.ENSP00000350402

OMIM: 604371

Promotions