MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Isoform 2 may act as an inhibitor of GnRH-R signaling.
Gene References into Functions
Data, including identification of GnRH/GnRH-receptor system in both ovary and endometrium, suggest that the spectrum of action of GnRH/GnRH-receptor system extends outside its well-known hypothalamic functions. [REVIEW]PMID:29544634
c.364C>T in GNRHR is a complete loss-of-function mutation which caused idiopathic hypogonadotropic hypogonadism.PMID:29777911
GNRHR (and GNRH) are expressed in trophoblast cell populations and fallopian tube epithelium at tubal ectopic pregnancy sites.PMID:26920257
first description of a GNRHR gene mutation in three patients diagnosed with polycystic ovary syndrome.PMID:28348023
We showed that GNRHR and LHCGR were highly expressed in some wildtype aldosterone-producing adenoma samples, and that they positively correlated with GnRH-stimulated aldosterone production.PMID:27196470
Results show that biallelic gonadotropin releasing hormone receptor (GNRHR) mutations are not a frequent cause of age-related androgen decline in men.PMID:26044071
GnRH receptors on triple negative breast cancer cells can be used for targeted therapy of these cancers with GnRH agonist triptorelinPMID:25293576
study found a novel mutation in PROK2 in two male siblings presenting normosmic congenital hypogonadotropic hypogonadism, in whom a mutation in the GNRHR gene had been previously described, suggesting the possibility of a digenic inheritancePMID:25531638
A high prevalence of endometriosis, polymorphism in the LHCGR and GnRH1 and progonadoliberin-2 antibodies in serum was found among the patients with severe dysmotility after treatment with GnRH analogs.PMID:25592315
Mutations in GNRHR do not appear to be involved in the pathogenesis of constitutional delay of growth and puberty.PMID:25016926
Studies of the gonadotrope suggest that extracellular regulatory loops may play a central role in the regulation of gonadotropin gene expression by gonadotropin-releasing hormone (GnRH) receptor activation.PMID:23994024
Interaction between ER-associated Hsp40s and the Vps34 complex permits the selective degradation of ERAD-resistant membrane protein GNRHR via ERQC autophagy.PMID:24685158
A species specific motif participates in recognition of endoplasmic reticulum retention of the GnRHR by calnexin.PMID:23891857
The GnRH receptor is differentially expressed in pituitary gonadotrope cells vs. prostate cancer cells.PMID:23380421
We have generated human GNRHR1 knock-in mice and described their reproductive phenotype.PMID:23632635
Reversal of hyogonadotropic hypogonadism and late-onset hypogonadism are reported in an untreated patient with a R262Q mutation of GNRHR.PMID:22788855
Data show that GnRHR activation affected several cellular markers of locomotion, including actin organization and polymerization as well as active RhoA-GTP levels.PMID:23176180
SET protein interacts with intracellular domains of the gonadotropin-releasing hormone receptor and differentially regulates receptor signaling to cAMP and calcium in gonadotrope cellsPMID:23233674
Review of the role of GNRHR in neoplasms and as a treatment target. [Review Article]PMID:22778172
Data suggest that mutations in GNRHR and TACR3 are the most common causative mutations in normosmic idiopathic hypogonadotropic hypogonadism in families in Turkey.PMID:22766261
GnRHR mutations can be classified into partial or complete loss of function mutations. Partially inactivating substitutions of the GnRHR frequently found in familial hypogonadotrophic hypogonadism are Q106R and R262Q.PMID:23155690
Normosmic Congenital hypogonadotropic hypogonadism (HH)patients with a R262Q mutation in GHRHR accompanied by other GNRHR mutation may be prone to reversal of HH.PMID:22724017
unidentified genetic and/or environmental factors may combine with singly mutated GNRHR alleles to produce reproductive phenotypesPMID:22745237
A potential role of GnRHR gene polymorphisms in the development of breast cancer.PMID:22710726
Molecular deficiencies of the two novel GNRHR1 mutations lead to the CHH phenotype when present as a compound heterozygote.PMID:22679506
molecular mechanisms involved in GnRH/GnRHR signaling at the maternal-fetal interface. {Review]PMID:22024993
Hypogonadotropic hypogonadism due to being homozygous for the G416A transition in the GNRHR gene. The parents were heterozygous mutation carriers.PMID:21717411
the TM4/ECL2 junction of GNRHR is crucial for peptide ligand binding and, consequently, for ligand-induced receptor conformational selectionPMID:21832286
Thr104Ile and Tyr108Cys gonadotropin-releasing hormone receptors are misfolded structures whose function is rescuable by genetic and/or pharmacological strategiesPMID:21277937
Positioning of the long extracellular loop within the seven-alpha-helical bundle regulates GnRH receptor stability, proper trafficking, and function.PMID:21527534
P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.PMID:21317933
The findings suggest novel pathophysiological links between the GNRHR locus and thyroid function and insulin secretion in polycystic ovary syndrome patients.PMID:21274726
Data suggest that a subset of patients with primary aldosteronism has aberrant LHR and GNRHR expression, which could modulate aldosterone secretion.PMID:21330483
we discuss the composition and role of membrane rafts in cell signaling and examine evidence that the mammalian type I GnRHR is constitutively and exclusively localized to these membrane microdomains in various experimental model--REVIEWPMID:20836995
LH-RH receptor expression persisted despite prolonged exposure to LH-RH agonists in prostate cancer.PMID:20670943
GnRHa may be an effective stimulator of local peritoneal fibrinolytic activity, as it decreases PAI-1 secretion in peritoneal Met5A cells by a mechanism linked to GnRHR.PMID:20236028
Study conclude that the mammalian GnRH-RI is an intracellular GPCR that is expressed on the nuclear membrane.PMID:20628612
analysis of Pulsatile and sustained gonadotropin-releasing hormone (GnRH) receptor signalingPMID:20507982
Data show that among those GnRH receptor monoclonal antibodies, GHR-103, GHR-106 and GHR-114 exhibit high affinity and specificity to GnRH receptor as judged by the whole cell binding.PMID:20182875
Site-directed mutagenesis of the C-terminal domain of extracellular loop 2 of the human GnRH receptor showed that a minimum of two mutations is needed in this region for agonist activity of antagonist 135-18PMID:11981042
the E(90)K mutation impairs hGnRHR-effector coupling; sequence modifications that enhance surface expression of the receptor restore functionPMID:11994356
Novel homozygous splice acceptor site GnRH receptor (GnRHR) mutation: human GnRHR "knockout". amenorrhea and absent thelarche and pubarchePMID:12050282
conserved physical linkage in medaka and human genomesPMID:12054603
our results strongly indicate a role of the C/EBP and GATA motifs in regulating GnRHR gene transcription in human granulosa-luteal cellsPMID:12089350
Locally expressed LHRH receptors mediate the oncostatic and antimetastatic activity of LHRH agonists on melanoma cells.PMID:12161512
results clearly indicate a role of octamer transcription factor-1 in the transcriptional repression of the human gonadotropin-releasing hormone receptor genePMID:12446597
A missense mutation in this gene is found in a case of complete hypogonadotropic hypogonadism.PMID:12568864
The dominant-negative effect of the naturally occurring receptor mutants for the WT hGnRHR, which has intrinsic low maturation efficiency suggesting that this effect and the diminished plasma membrane expression is a recent evolutionary event.PMID:12843188
direct role for the GnRHR in mediating antiproliferative events in two cell systems, neither of which was derived from extrapituitary reproductive tumors.PMID:14551223
Neurons express GnRH receptor and responded to GnRH with time- and dose-dependent increases in GnRH gene expression and protein release.PMID:14565958
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Pituitary, ovary, testis, breast and prostate but not in liver and spleen.