LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it’s possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This protein is a minor sialoglycoprotein in erythrocyte membranes.
Gene References into Functions
through bioinformatic analysis, identified extensive variation in GYPB transcript levels in individuals from Benin, suggesting selection from malaria pressure; collective data suggest that the GPA and GPB receptors are of greater importance than the GPC receptor, supporting a hierarchy of erythrocyte receptor usage in P. falciparumPMID:28760933
A novel GYPB mutation (c.270+5G>A) accounting for the S-s-U+(var) phenotype was identified.PMID:24738877
Substitution of GPB with Gp.Mur significantly reduced the expression of Rh antigen and RhAG on the Mi.III(+/+) erythrocyte membranePMID:21883272
an increased susceptibility to infection by this parasite is associated with the glycophorin B S+ variant in Brazilian AmazonsPMID:21283638
Indochina I strain of P. falciparum is not dependent on glycophorin B to invade erythrocytse through a trypsin-resistant pathway as are the strains 3D7, HB3, and Dd2.PMID:14638759
The S-s-U+var phenotype arises from changes in or around GYPB exon 5.PMID:14641872
Alternative to conventional tube technique for mass screening for MNS hybrids, especially when specific antisera are not available.PMID:17561857
Immunoblotting showed the presence of monomer and dimer forms of a GP(A-B) hybrid and an absence of GPA and GPB. Sequencing of DNA and PCR-RFLP using the restriction enzyme RsaI confirmed the presence of a hybrid GYP(AB).PMID:18284304
The erythrocyte-binding domain, region 2 of EBL-1, bound glycophorin B(+) butPMID:19279206
This study reports for the first time the molecular mechanisms responsible for the S-s- phenotype in a population of African Brazilians and provides new information about the frequency and molecular bases of the GYPB*S silent gene in this population.PMID:19856717
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.