CCKBR; CCKRB; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-447
Target Protein Sequence
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL PDEDPPTPSIASLSRLSYTTISTLGPG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.; Isoform 2 is constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism.
Gene References into Functions
We concluded that low serum gastrin is related to increased risk of ER(+) BC development. The results also established that CCKBR/ERK/P65 signaling function is generally tumor suppressive in ER(+) BC, indicating therapies should focus on restoring, not inhibiting, CCKBR/ERK/P65 pathway activity.PMID:30115027
High CCK2R expression is associated with cancer.PMID:26910279
These results suggest that Z-360 exerts an anti-tumor effect through a reduction in anti-apoptosis factors by blocking CCK2RPMID:28739697
High CCK-BR expression is associated with Gastric Cancer.PMID:27518872
There is no identifiable link between nuclear CCK2R expression and all the clinicopathological characteristics examined in a cohort of Taiwanese colon cancer patients.PMID:26508021
Data indicate that variant c.811+32C>A in cholecystokinin-B receptor gene (CCKBR) does not have a significant impact on pancreatic cancer risk or survival in a Hungarian cohort.PMID:26646278
This study showed that CCK2 receptors were highly expressed within the cytoplasmic area of cancerous cells, whereas the levels were very low in normal tissues.PMID:26520651
CCK-BR SNP predicts survival and should be studied as a candidate genetic biomarker for those at risk of pancreatic cancer.PMID:25469546
treatment with gastrin, a CCK2R agonist, stimulated the secretion of GLP-1, and that this effect was likely due to increased expression of proglucagon and PCSK1 (also known as prohormone convertase 3 (PC3 gene)).PMID:25601282
Our results indicate a promoting role of CCK2R on GIST tumourigenesis, particularly in tumours of gastric origin.PMID:22786615
The gastrin receptor is a promising tumor cell surface target for future prostate-cancer-specific imaging applications.PMID:24211650
DeltaFosB induction in prelimbic area occurred selectively in susceptible mice after chronic social defeat stress and produced these effects partly through induction of the cholecystokinin (CCK)-B receptor.PMID:24623766
some CCKBR polymorphisms may contribute to an underlying predisposition towards suicidal behaviour in bipolar disorder.PMID:23890582
Gastric mucosal injury with H. pylori infection destroys the pH barrier on the foveolar epithelium and may induce gastrin receptor expression through pH changes.PMID:23053898
Suggest that CCK2R-mediated COX-2 up-regulation via JAK2/STAT3/PI3K/Akt pathway is involved in the proliferative effect of gastrin on human gastric cancer cells.PMID:23376640
Data suggest that mutations in cholecystokinin 2 receptor (CCK2R) may promote tumorigenesis through deregulated receptor activity and highlight the importance of evaluating CCK2R inhibitors to block both the normal and mutant forms of the receptor.PMID:22516348
These results show the importance of the CCK-BR in regulation of growth and apoptosis in pancreatic cancer.PMID:22442157
A novel splice variant acting as a dominant negative on membrane density of the CCK2R may be of importance for the pathophysiology of certain tumors and for their in vivo CCK2R-targeting.PMID:22040601
A single nucleotide polymorphism in the cholecystokinin-B receptor that alters splicing predicts survival in pancreatic cancer.PMID:22277584
proximal DNA elements within the human gastrin gene promoter mediate interactions between JunD, which induces gastrin gene expression and menin, which suppresses JunD-mediated activation.PMID:21852362
Genetic polymorphisms in cholecystokinin B receptor may play a role in antipsychotic induced weight gain in schizophrenia patients.PMID:20732371
Regulation of membrane cholecystokinin-2 receptor by agonists enables classification of partial agonists as biased agonists.PMID:21156802
a positive-feedback loop whereby gastrin, acting via the CCK2 receptor, increases its own expressionPMID:20932834
The CCK(2)splice variant with retention of intron 4 (Ri4sv) is a marker of specific gastrointestinal and lung tumours.PMID:19627395
The cholecystokinin 2 receptor allele with 21 CT repeats was associated with multiple chemical sensitivity when compared in post hoc analyses with all individuals from the population sample.PMID:20185366
Results show that signaling through ACAT/cholesterol esterification is a novel pathway for the CCK2R that contributes to tumor cell proliferation and invasion.PMID:19502590
Expression of gastrin and cholecystokinin 2 (CCK(2)) receptor splice variants are upregulated in human colonic adenomas where they are thought to contribute to tumor growth and progression.PMID:19697327
A misspliced form of the cholecystokinin-B/gastrin receptor in pancreatic carcinoma: role of reduced sellular U2AF35 and a suboptimal 3'-splicing site leading to retention of the fourth intron.PMID:11830556
hGARE is proposed as a new candidate target gene in microsatellite instability tumorigenesis.PMID:11896205
Hyper-gastrinaemia may promote proliferation of human colonic adenomas that expressnon-truncated CCK-2 receptor isoforms.PMID:12189558
data represent the first evidence for role in regulating cell-cell and cell-substrate adhesion and support a role in the progression of carcinomaPMID:12400008
data support the hypothesis that cholecystokinin-B receptor mediated activation of the hypothalamic-pituitary-adrenal axis is relatively resistant to cortisol feedback inhibitionPMID:12510010
induction by oncogenic ras in LoVo and Colo320HSR colon cancer cell linesPMID:12761477
Cholecystokinin-A receptor and B receptor polymorphisms, considered alone, showed no correlation with hallucinations in Parkinson's diseasePMID:12777967
this is the first report that provides evidence for the high tumorigenic effect of a constitutively active CCK2R mutant, thus raising a potential role of the CCK2R in human cancer.PMID:12955087
findings suggest physiological functions for the CCK(2)R in calcitonin-secretion and gene expression as well as a pathophysiological role in medullary thyroid carcinoma proliferationPMID:14759564
CCK exerts secretagogue action on human ZG cells, acting through CCK2-Rs coupled to the adenylate cyclase/protein kinase A signaling cascadePMID:15001623
A role is implicated for the CCKB receptor gene in suicide completers, the highest gene expression being observed in the cerebellum followed by cingulate gyrus and pre-frontal cortex compared to their age and sex-matched controls.PMID:15036586
Gastrin/CCK-B receptor autocrine or paracrine pathway may possibly play an important role in the progression of gastric cancer.PMID:15040018
CCK2i4svR, a splice variant of cholecystokinin-2 receptor, has a role in agonist-independent activation of Src tyrosine kinasePMID:15292208
Findings are consistent with the notion that genetic variation in the CCK B receptor neurotransmitter system contributes to the pathogenesis of panic disorder.PMID:15354400
the MEK1/ERK1/2 pathway couples the CCK2 receptor to nuclearization and DNA binding of Egr-1PMID:15611055
analysis of interspecies polymorphism in the human and rat cholecystokinin receptor-2 and its effect on the cholecystokinin binding sitePMID:15817487
Photoaffinity labeling of the type B CCK receptor provides evidence for the peptide-binding domain to include receptor loop and amino-terminal tail regions residing at the extracellular surface of the plasma membrane.PMID:15850403
human normal, inflammatory, and malignant gastric tissues simultaneously express the classical and alternative splicing cholecystokinin-B/gastrin receptor genesPMID:15989082
Study confirms that a high proportion of gastric cancer tissue samples express the gastrin/CCKB receptor, which can stimulate the growth of gastrin/CCKB receptor-positive gastric cancer cells.PMID:16012719
CCK2 gastrin receptor may have a role in leukemiaPMID:16142371
Gastrin exerts an antiproliferative and proapoptotic effect on human colon cancer cells expressing the wild-type CCK2 receptor.PMID:16143134
The expression rates of gastrin and gastrin receptor are high (about a half) in gastric carcinoma tissues, and there is an association between gastrin and gastrin receptor expression.PMID:16228228
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Isoform 1 is expressed in brain, pancreas, stomach, the colon cancer cell line LoVo and the T-lymphoblastoma Jurkat, but not in heart, placenta, liver, lung, skeletal muscle, kidney or the stomach cancer cell line AGS. Expressed at high levels in the smal