GJC1; GJA7; Gap junction gamma-1 protein; Connexin-45; Cx45; Gap junction alpha-7 protein
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-396
Target Protein Sequence
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMR WKQHRALEETEEDNEEDPMMYPEMELESDKENKEQSQPKPKHDGRRRIREDGLMKIYVLQ LLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG LCLLLNIWEMLHLGFGTIRDSLNSKRRELEDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ YTELSNAKIAYKQNKANTAQEQQYGSHEENLPADLEALQREIRMAQERLDLAVQAYSHQN NPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
our data highlighted the critical role of CX45 in reprogramming and may increase the cell division rate and result in an accelerated kinetics of iPSCs production.PMID:28352086
human Cx40/Cx45 and Cx43/Cx45 heterotypic gap junctions were investigated by recombinant expression in GJ deficient cells.PMID:28760564
Observations involving both N- and C-domains of CaM to interact with the Cx45 peptide differ from the embraced interaction with Cx50 from another connexin familyPMID:28963343
Human deltoid muscle biopsies of 5 Chilean dysferlinopathy patients exhibited the presence of muscular connexins (Cx40.1, Cx43 and Cx45).PMID:27229680
Connexin45 has much more rapid gating kinetics than connexin43PMID:25401181
Results found that the expression of Cx26 and Cx45 had no prognostic value but Cx43 was upregulated in tumour epithelia and membrane Cx43 expression was associated with short overall survival time.PMID:24788723
Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblastsdepend of Cx43 rather than on Cx45.PMID:21674053
Our data suggest that GJA7 alterations have no or low genetic relevance in nonsyndromic hearing loss in populatins from Turkey, South Africa, United Kingdom, United States, and China.PMID:21254920
DNA hypermethylation of the promoter region of GJC1, encoding connexin45, is an important mechanism in silencing gene expression in colorectal cancer.PMID:21406965
Study shows that fusion of a V5/6-His tag (hexa moiety M r = 0.93 kDa) to the CT segment of Cx40, Cx43 and Cx45 does not prevent the cells from forming channels.PMID:21424225
connexin genes Gjd2 coding for mCx36, Gjc1 coding for mCx45 and Gja10 coding for mCx57 in the mouse, a subset of 4 connexin genes, including the unique GJA9 (Cx59) and GJA10 (Cx62), could be detected at least as transcript isoforms in the human retina.PMID:20979653
Results show that Cx40, Cx37, Cx43 and Cx45 were expressed within the glomeruli.PMID:20530971
Studies indicate that 21 different Cxs have been detected and they are generally named according to their approximate molecular mass in Kda, e.g. Cx32, Cx43 and Cx45.PMID:19883623
Data suggest that the dynamic changes of connexins 43, 40 and 45 during mouse cardiac development appear to be mirrored in the human.PMID:12064615
abnormal expression of connexin43 and connexin45 in nasopharynx tissues may be associated with cancerization and squamatization of human nasopharynx tissuePMID:12452056
mRNA levels of connexins in different sizes of luteinized normal and hyperstimulated follicles.PMID:14667880
The staining patterns for Cx45 rather were typified by granular cytoplasmic staining.PMID:14766937
Cx45 has a complex binding interaction with zonula occludens-1 (ZO-1) that involves either an extended carboxyl terminal domain or two distinct binding sites.PMID:16463142
Cx40/Cx45 junctions demonstrate electrical signal transfer asymmetry that can be modulated between unidirectional and bidirectional by small changes in the difference between holding potentials of the coupled cells.PMID:17189315
a cross-talk between CFTR and a variety of gap junction channels. Cytoskeletal scaffolding proteins and/or other intermediate cytoplasmic proteins are likely to play a role in CFTR-connexins interaction.PMID:17546509
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.