GJA5; Gap junction alpha-5 protein; Connexin-40; Cx40
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
2-358
Target Protein Sequence
GDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSG SYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTT LHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKP RQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQV RGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
Atrial Fibrillation (AF)-linked Cx40 mutants impair gap junction and/or hemichannel function, which may predispose the mutant carriers to AF.PMID:29587382
GJA5 gene rs35594137 polymorphism is significantly associated with sudden cardiac death in the examined group.PMID:28577096
Missense polymorphism in GJA5 independently associated with increased risk for Complete heart block after surgical repair of Congenital Heart Disease.PMID:27826129
Cx40 genetic polymorphisms increase atrial fibrillation risk in Uyghur and Han residents of Xinjiang.PMID:27813566
Cx 40 (rs35594137) was associated with atrial fibrillation; in the Uygur population, Cx 40 (rs35594137) should be considered as an independent risk factor for patients with atrial fibrillation, who might have racial differences in rs35594137 variant frequenciesPMID:26634538
This is a review summarizing atrial fibrillation-linked somatic and germline mutations in the gene encoding Cx40. Multiple impairments were observed in these mutants, including impaired gap junction function by abnormal localization or function, as well as increased hemichannel function.PMID:24656738
Human atrial myocytes express Cx40 and Cx43. However, in vitro expression study indicates that human Cx40 is not able to dock with Cx43 to form heterotypic gap junction channels. This study designed two Cx40 variants, D55N or P193Q. Both of them were successful in forming functional heterotypic gap junction channels with Cx43.PMID:26625713
Two polymorphisms in the Cx40 promoter are associated with hypertension and left ventricular hypertrophy preferentially in men.PMID:25992486
Report interaction between ALK1 signaling and connexin40 in the development of arteriovenous malformations.PMID:26821948
Reduced Cx40 levels and heterogeneity of its distribution (relative to Cx43) are common in atrial fibrillation.PMID:25200600
Two atrial fibrillation-linked germline Cx40 mutants, V85I and L221I, were investigated.PMID:24733048
Degradation of a connexin40 mutant linked to atrial fibrillation is accelerated.PMID:24973497
These findings provide evidence that the connexin 40 Q49X mutant is capable of impairing gap-junction distribution and function of key atrial connexins, which might play a role in the predisposition to and onset of atrial fibrillation.PMID:24626989
heterozygous Cx40A96S mice exhibit prolonged episodes of induced atrial fibrillation and severely reduced atrial conduction velocities similar to the corresponding human patient.PMID:24060583
4 novel heterozygous GJA5 mutations, p.K107R, p.L223M, p.Q236H and p.I257L, were identified in 4 of 310 unrelated AF patients.PMID:23292621
the germline familial mutations in Cx40 impair the gap junctions through different mechanisms, which may predispose the mutant carriers to AF.PMID:23348765
Presence of the Cx40 minor allele (-44 G --> A) results in a uniform down-regulation of right atrial appendage Cx40 protein which was not significantly related to development of post-operative AF.PMID:22423256
Pro265Ser variant in the carboxyl-terminus of connexin 40 alters GAP junctions and increases risk for tetralogy of Fallot.PMID:22713807
Genotyping of rs10465885 showed that the patients with early-onset lone AF were more likely to carry the A allele compared with controls (odds ratio = 1.30; P = 0.011).PMID:23040431
Cx40 coding SNPs are uncommon in atrial fibrillation populations, although rare mutations in this gene may lead to atrial fibrillation pathogenesis.PMID:23134779
Results implicate GJA5 as the gene responsible for the congenital heart disease phenotypes observed with copy number imbalances at this locus.PMID:22199024
our study could not detect an association of Cx40 promoter polymorphisms and CAD in humanPMID:22405441
This is the first evidence of intrinsic differences in the Ca2+ regulatory properties of Cx43 and Cx40.PMID:22422398
Heteromeric cotransfection of Cx40-WT and Cx40-Q58L resulted in homogenous distribution of proteins in the plasma membrane rather than in membrane plaques in approximately 50% of cells; well-defined gap junctions were observed in other cells.PMID:22247482
Regulation of endothelial connexin40 expression by shear stress via PI3K/Akt pathway.PMID:22021330
Association between hereditary sick sinus node syndrome and connexin 40 gene polymorphism was demonstrated.PMID:21649591
There is an alternate promoter polymorphism that directly affects levels of Cx40 mRNA in vivo and is associated with early-onset lone atrial fibrillation.PMID:21076161
Three novel connexin40 mutations (p.V85I, p.L221I, and p.L229M) were identified which co-segregated with atrial fibrillation and were absent in the controls without atrial fibrillation.PMID:20650941
In patients with cerebral ischemic events, without prior CVD, a higher prevalence of the Cx40 gene polymorphism, as a marker of underlying idiopathic atrial fibrillation appeared to be absent.PMID:19494781
Data suggest that these dynamic changes of connexins 43, 40 and 45 during mouse cardiac development appear to be mirrored in the human.PMID:12064615
Our data show that the presence of Cx40 does not allow GJIC and is associated with the extravillous phenotypePMID:12397213
endothelial gap junction protein connexin 37 and connexin 40-mediated communication in the development and/or functional maintenance of segments of the mouse vasculature.PMID:12435353
505 CHD cases were screened for the Cx40 gene to see if altered copy number associated with a cardiac phenotype. 3 cases carred deletions on chromosome 1q21.1 spanning ACPL1, Cx40, and Cx50 genes, with aortic arch anomalies being a particular feature.PMID:15117819
The -44A allele & -44AA genotype were significantly more frequent in subjects with prior AF than in those without, providing strong evidence linking Cx40 polymorphisms to enhanced atrial vulnerability and increased risk of AF.PMID:15297374
Coinheritance of Cx40 polymorphisms is a possible genetic factor that modifies the clinical manifestation of this inherited arrhythmia.PMID:16188595
We conclude that decidual secretion of growth factors, such as EGF, may act to prime trophoblast for migration/invasion through modulation of connexin expression and function.PMID:16545451
there may be more than one conformation form of the connexin40 carboxyl tail with roles in atrial conduction and arrhythmogenesisPMID:16600287
Cx40 polymorphisms are associated with enhanced spacial dispersion of refractoriness and thus with susceptibility to reentry and atrial fibrillationPMID:16646598
Four novel heterozygous missense mutations were identified in 4 of the 15 patients. Mutations in GJA5 may predispose patients to idiopathic atrial fibrillation by impairing gap-junction assembly or electrical coupling.PMID:16790700
The two SNPs in the promoter region of the Cx40 gene were significantly associated with atrial fibrillation and the Cx40 (-44A +71G) haplotype was associated with a higher risk for atrial fibrillation.PMID:16814413
a cross-talk between CFTR and a variety of gap junction channels. Cytoskeletal scaffolding proteins and/or other intermediate cytoplasmic proteins are likely to play a role in CFTR-connexins interaction.PMID:17546509
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.