GJA4; Gap junction alpha-4 protein; Connexin-37; Cx37
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
2-333
Target Protein Sequence
GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDP QVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMR ARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLA SSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Gene References into Functions
Data show that fluid shear stress activates NOTCH signaling, which upregulates GJA4 (commonly, Cx37) and downstream cell cycle inhibitor CDKN1B (p27).PMID:29247167
CONNEXIN-37 gene polymorphisms are an ischemic stroke risk factor in Northern Han Chinese.PMID:29631604
ur study describes for the first time an association of drug-resistant non-structural heart disease AF with the Cx37 1019C > T gene polymorphism. We also confirmed the association of the Cx40 - 26G > A polymorphism in patients with AF and structural disease.PMID:29351227
the present study reported on a Cx37 variant in two Caucasian primary ovarian insufficiency (POI)patients, which was absent in control Caucasian populations, and which had a deleterious effect in vitro. It is therefore suggested that in the genetic context of the Caucasian population, this variant may contribute to POI.PMID:29207017
This study shows that Cx37 C1019T and Cx40 A71G polymorphisms are not associated with cardioprotective role in Egyptians.PMID:28969560
The CX37 rs1764390 G allele is associated with increased susceptibility to sepsis, which may be involved in the process of sepsis via mediating the plasma levels of NO, IL-6 and CRP.PMID:27939333
The C allele in the CX37 gene might be associated with susceptibility to dilated cardiomyopathy (DCM) in Chinese Han; female carriers of the C allele had higher DCM risk compared with TT homozygotes than malesPMID:25501978
The protective effect of the T allele of the Cx37 gene might be strongly modified by smoking; in women, this effect could be mediated through stem cells.PMID:26588185
Our findings suggest that the Cx37 C1019T variation may contribute to the risk of PCOS in the South Indian women.PMID:26656196
Review/Meta-analysis: Cx37 C1019T was a risk factor for myocardial infarction and a protective factor for coronary artery disease.PMID:24937033
The C allele in the CX37 gene might be associated with the susceptibility to EH in population of Wuxi, China.PMID:24685073
three variants in PNPLA3 gene may be a genetic risk factor for NASHPMID:24773516
the C1019T polymorphism may be a moderate risk factor for MI and that DM was likely a potential source of between-study heterogeneity. [META-ANALYSIS]PMID:24333099
Determination of Cx37 C1019T and eNOS G894T polymorphisms may be used to detect a genetic predisposition to the development of myocardial infarction in patients with hemodynamically insignificant atherosclerosis and in apparently healthy individuals.PMID:24261225
1019C/T polymorphism in the CX37 gene is associated with susceptibility to coronary artery disease as well as restenosis after coronary stenting in male patients.PMID:23926016
It is suggested that the polymorphism in the Cx37 gene (but not Cx40 gene) potentially plays a significant role in the manifestation of AMI disease in Iranian populationPMID:23724624
C1019T polymorphism in the connexin 37 gene is associated with Helicobacter pylori infection and gastric cancer.PMID:22901223
We report the presence of connexins in platelets, notably connexin37, and that the formation of gap junctions within platelet thrombi is required for the control of clot retraction.PMID:22528526
GJA4 polymorphism is not associated with stroke risk in the Taiwanese population.PMID:22305353
We propose that the establishment of gap junctional communication between Cx37-expressing platelets provides a mechanism to limit thrombus propensity.PMID:21810657
In women with higher fasting glycemia TT genotype of Cx37 polymorphism was protective against subclinical atherosclerosis.PMID:21617605
The gene for Cx37 was associated with subclinical atherosclerosis in women with type 1 and 2 diabetes and in women with advanced central obesity.PMID:21208019
Connexin 37 genetic variants significantly affect carotid IMT and contribute to future development of ischemic strokePMID:21044781
Endothelium-dependent vasodilation is primarily mediated by connexin 37 in mesenteric artery.PMID:21172909
Cx37 C1019T polymorphism is associated with tumour cell proliferation.PMID:20705954
Data show for the first time a functional and specific interaction between eNOS and Cx37 in endothelial cells.PMID:20081116
These data suggest that alterations of specific connexins, in this case connexin 37, and resulting changes in intercellular communication may modulate endothelial cell growth and death.PMID:15194487
NO inhibits the intercellular transfer of small molecules by a specific influence on Cx37PMID:15481066
Here, data for human connexin37 (hCx37) hemichannels indicate that voltage gating can be explained as block/unblock without the necessity for an independent voltage gate.PMID:15504903
T1019 Cx37 SNP has shown to be a risk factor for acute myocardial infarction (AMI).PMID:15982495
investigated whether the allelic variants 1019C and 1019T are differentially predictive of increased risk for coronary artery disease (CAD) and myocardial infarction (MI)PMID:16677656
The connexin37 C1019T polymorphism is not related with markers of subclinical atherosclerosis in young adults in FinlandPMID:17196598
Cx37 is expressed in the vascular endothelium as well as in monocytes and macrophages and these three cell types are key players in atherogenesis.PMID:17318613
Connexin 37 is expressed in the granulosa layer of follicles in the human ovary, and expression of Cx37 in granulosa cells was not different between poor responder and nonpoor responder to ovulation induction.PMID:17531234
Study suggests that GJA4 gene C1019T polymorphism and/or its related C-C-D haplotype might contribute to an increased risk of CAD and potentially play an important role in the development of coronary atherosclerosis in northern Han Chinese.PMID:18073482
variation in the connexin gene may modify effects risk factors have on vascular functionPMID:18605953
As much as half the length of the connexin N-terminus can be deleted without affecting formation of gap junction plaques, but an intact N-terminus is required for hemichannel gating and intercellular communication.PMID:18664489
The electrical properties of Cx37 hemichannels (HCs) and gap junction channels (GJCs) were measured with voltage-clamp methods.PMID:19166859
connexin37 C1019T polymorphism is associated with peripheral artery disease in Japanese type 2 diabetic patients.PMID:19407064
The alpha helical structure of the connexin 37 N terminus may be dispensable for protein localization, but it is required for channel and hemichannel function.PMID:19478091
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.