Recombinant Human Galanin receptor type 2 (GALR2)

Code: CSB-CF009224HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5390

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GALR2

Uniprot NO.

O43603

Alternative Names

GALR2; GALNR2; Galanin receptor type 2; GAL2-R; GALR-2

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-387

Target Protein Sequence

MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the hormone galanin and GALP. Receptor for the hormone spexin-1. The activity of this receptor is mediated by G proteins that activate the phospholipase C/protein kinase C pathway (via G(q)) and that inhibit adenylyl cyclase (via G(i)).

Gene References into Functions

Study provides evidence that GAL and GALR1/2 genes were identified as aberrantly methylated in head and neck squamous cell carcinoma. PMID:27685843
GAL and its receptors, GALR1 and GALR2, play a role in head and neck squamous cell carcinoma tumorigenesis PMID:26572146
The G protein-coupled receptor GALR2 promotes angiogenesis in head and neck cancer PMID:24568968
In HEp-2 cells, GALR2-mediated apoptosis was caspase-independent. PMID:24168112
Activation of GalR2 leads to elevation of intracellular Ca(2+) due to Ca(2+) efflux from endoplasmic reticulum through IP3R sequentially opening BK alpha channels. PMID:24602615
The expression of GALR2 mRNA is lost in head and neck squamous cell carcinoma as a consequence of DNA methylation.Silencing of the GALR2 gene by methylation may be a critical event in head and neck squamous cell carcinoma. PMID:24122450
galanin receptor 2 promotes cell proliferation and survival, and promotes tumor growth, consistent with an oncogenic role for GALR2 in squamous cell carcinoma of the head and neck PMID:21345369
Elevated expression of galanin receptors in childhood neuroblastic tumors PMID:11867941
study indicates that a high level of GalR2 galanin receptor expression is able to inhibit cell proliferation and induce apoptosis in neuroblastoma cells PMID:14592962
There was no effect of GALR2 on alcoholism risk. PMID:17083333
point to GalR2 as a possible target for therapeuthic interventions in pheochromocytoma PMID:18272487

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed abundantly within the central nervous system in both hypothalamus and hippocampus. In peripheral tissues, the strongest expression was observed in heart, kidney, liver, and small intestine.

Database Links

HGNC: 4133

UNIGENE: Hs.666366

KEGG: hsa:8811

STRING: 9606.ENSP00000329684

OMIM: 603691

Promotions