Recombinant Human G-protein coupled receptor 84 (GPR84)

CSB-CF865107HU
Size:
20μg
20μg100μg
US$5458
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
GPR84
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-396
Target Protein Sequence
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTT ILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQE LDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTW LNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system.
Gene References into Functions
  1. GPR84 modulates TNFalpha mRNA expression in the LPS tolerant monocytes. PMID:28404994
  2. we show functional similarities but also some important differences between GPR84 and FFA2R in human phagocytes, thus providing some mechanistic insights into GPR84 regulation in blood neutrophils and cells recruited to an aseptic inflammatory site in vivo. PMID:29477577
  3. Data suggest that cytokines TNFalpha and interleukin-1b markedly reduce GPR120/FFAR4 expression in adipocytes; in contrast, these cytokines induce expression of GPR84 and GPR41/FFAR3 in adipocytes. These studies were conducted in adipocytes cultured from subcutaneous adipose tissue. (GPR = G-protein coupled receptor; FFAR = free fatty acid receptor) PMID:28835131
  4. concluded that diindolylmethane was a positive allosteric modulator for GPR84 PMID:25425658
  5. A previously unrecognized role of GPR84 in maintaining fully developed acute myeloid leukemia by sustaining aberrant beta-catenin signaling in leukemic stem cells. PMID:25293777
  6. Medium-chain fatty acid-sensing receptor, GPR84, is a proinflammatory receptor. PMID:23449982

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed predominantly in hematopoietic tissues. High levels detected in the bone marrow and lower levels in the peripheral leukocytes and lung. Also expressed in brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta and intestine. Within
Database Links

HGNC: 4535

UNIGENE: Hs.306199

KEGG: hsa:53831

STRING: 9606.ENSP00000267015

OMIM: 606383

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products