Home
Product
Protein
Transmembrane Proteins
Recombinant Human G-protein coupled receptor 6 (GPR6)

Recombinant Human G-protein coupled receptor 6 (GPR6)

Code: CSB-CF009822HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5203

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GPR6

Uniprot NO.

P46095

Alternative Names

GPR6; G-protein coupled receptor 6; Sphingosine 1-phosphate receptor GPR6

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-362

Target Protein Sequence

MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQL SAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLL AGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRR TLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGI MLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCV VGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPS EV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons.

Gene References into Functions

The GPR6 gene influences the reinforcement learning rate in a computational, neurogenetic model. PMID:22487033
control of gene expression in vascular endothelial cells in the presence of fluid shear stress and determines that it is not a sphingosine 1-phosphate receptor PMID:12649592

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Note=Detected in the intracellular compartments. It is currently unclear whether this is a cell surface or intracellular receptor.

Protein Families

G-protein coupled receptor 1 family

Database Links

HGNC: 4515

UNIGENE: Hs.46332

KEGG: hsa:2830

STRING: 9606.ENSP00000275169

OMIM: 600553

Promotions