Home
Product
Protein
Transmembrane Proteins
Recombinant Human G-protein coupled receptor 3 (GPR3)

Recombinant Human G-protein coupled receptor 3 (GPR3)

Code: CSB-CF009800HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4964

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GPR3

Uniprot NO.

P46089

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-330

Target Protein Sequence

MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENAL VVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAF TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDG LTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYV ATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFR NQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Has a potential role in modulating a number of brain functions, including behavioral responses to stress, amyloid-beta peptide generation in neurons and neurite outgrowth. Maintains also meiotic arrest in oocytes.

Gene References into Functions

Results demonstrate that GPR3 signals at the plasma membrane and can be silenced by GRK2/beta-arrestin overexpression. These results also strongly implicate the serine and/or threonine residues in the third intracellular loop in the regulation of GPR3 activity. PMID:23826079
Gpr3 stimulates Abeta production via interactions with APP and beta-arrestin2. PMID:24069330
GPR3 is a key factor in the regulation of the nervous system and follicle development.[review] PMID:23732663
GPR3 is expressed in the ovary and testes, and is necessary for the regulation of meiosis in mouse. PMID:15591206
Mutations in GPR3 are not a common cause of premature ovarian failure in Chinese women. PMID:20158988
control of gene expression in vascular endothelial cells in the presence of fluid shear stress and classifies it as a sphingosine 1-phosphate receptor. PMID:12649592
We conclude that perturbations in GPR3 are not a common explanation for POF in this population. PMID:17953967

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed predominantly in the central nervous system, and at low levels in the lung, kidney, testis, ovary and eye. Highly expressed in regions of the brain implicated in the Alzheimer disease.

Database Links

HGNC: 4484

UNIGENE: Hs.66542

KEGG: hsa:2827

STRING: 9606.ENSP00000363136

OMIM: 600241

Promotions