MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it’s possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Gene References into Functions
We performed a label-free kinome short hairpin RNA screen and identified a putative signaling network of GPR35 in HT-29 cells, some of which was validated using gene expression, biochemical and cellular assays. The results showed that GPR35 induced hypoxia-inducible factor 1alpha, and was involved in synaptic transmission, sensory perception, the immune system, and morphogenetic processes.PMID:28425521
Using exome array data, we identified GPR35 as a novel susceptibility gene associated with chronic AIC in pediatric cancer patientsPMID:28961156
GPR35 interacts with CXCL17 in breast cancer cells.PMID:28943434
Small molecules that stimulate or block GPR35 activity can modulate vascular proliferation and migration.PMID:27064272
This article shows that GPR35 is the receptor of CXCL17.PMID:25411203
Single-nucleotide polymorphism in GPR35 gene is associated with Crohn's disease.PMID:25489960
results clearly show that R4.60, R(164), R(167), and R6.58 play crucial roles in the agonist initiated activation of GPR35.PMID:24347166
GPR35 shows associations in both ulcerative colitis (UC) and primary sclerosing cholangitis (PSC), whereas TCF4 represents a PSC risk locus not associated with UC. Both loci may represent previously unexplored aspects of PSC pathogenesis.PMID:22821403
This review presents a summary of what is known about the G-protein coupled receptors GPR35 and GPR55 and their potential characterization as lysophospholipid or cannabinoid receptors, respectively--{REVIEW}PMID:22820167
screening assays used to identification of small MW agonists; some compounds are species-specific agonists; agonists/ligands include zaprinast, cromolyn & dicumarolPMID:20919992
human iNKT cells express GPR35 functionally active in reducing IL-4 release.PMID:20599711
These results strongly suggest that 2-acyl lysophosphatidic acid is an endogenous ligand for GPR35.PMID:20361937
The results of the study demonstrate the coupling of GPR35 to endogenous G proteins that modulate neuronal Ca2+ channel and thereby provide evidence for a potential role of GPR35 in regulating neuronal excitability and synaptic transmissionPMID:17940199
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Internalized to the cytoplasm after exposure to kynurenic acid.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Predominantly expressed in immune and gastrointestinal tissues.