Recombinant Human G-protein coupled receptor 143 (GPR143)

Code: CSB-CF009758HU
Size:
20μg
20μg100μg
US$5517
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
GPR143
Uniprot NO.
Alternative Names
GPR143; OA1; G-protein coupled receptor 143; Ocular albinism type 1 protein
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-404
Target Protein Sequence
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSP ATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSA MWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPS VSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGA VIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNP AQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVG GQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for tyrosine, L-DOPA and dopamine. After binding to L-DOPA, stimulates Ca(2+) influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1 and relocalizes beta arrestin at the plasma membrane; this ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Plays also a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization and transport.
Gene References into Functions
  1. Three novel mutations, c.333_360+14del42insCTT, c.276G>A (p.W92X), and c.793C>T (p.R265X), were identified in GPR143 by PCR followed by Sanger sequencing in members of families with X-linked ocular albinism. PMID:28211458
  2. The findings of the present study expanded the gene mutation spectrum of GPR143 and investigated the clinical phenotype of patients with OA1 in the Chinese population. PMID:28339057
  3. c.758T>A mutation in exon 6 of the GPR143 gene is associated with X-linked ocular albinism. PMID:28397224
  4. Our results expand the spectrum of GPR143 mutations causing CN and further confirm the role of GPR143 in the pathogenesis of CN. PMID:27958203
  5. tyrosinase as a potential GPR143 binding protein opens new avenues for investigating the mechanisms that regulate pigmentation and neurogenesis. PMID:27720922
  6. X-linked ocular albinism type I, characterized by developmental eye defects, results from GPR143 mutations PMID:28632878
  7. This family was found to harbor a novel, likely pathogenic mutation in GPR143 resulting in a combined Stargart disease and heterozygous carrier phenotype in the affected sisters . PMID:27367509
  8. Here, we report a Chinese trio-family with the son who was affected by the X-linked ocular albinism in which a novel missense mutation in the GPR143 was observed. PMID:26547501
  9. Twenty Chinese patients, including 15 sporadic IN cases and 5 from X-linked IN families, were recruited and underwent molecular genetic analysis. We first performed PCR-based DNA sequencing of the entire coding region and the splice junctions of the FRMD7 and GPR143 genes in participants. PMID:27036142
  10. Downstream signaling from GPR143 controls RPE secretion of pigment epithelium-derived factor (PEDF), a potent neurotrophic and antiangiogenic factor. PMID:26741053
  11. Five mutations in GPR143 gene were detected in each of the five families, including a novel nonsense mutation of c.333G>A,two novel splicing mutations of c.360+1G>C and c.659-1G>A, a novel small deletion mutation of c.43_50dupGACGCAGC. PMID:26160353
  12. intronic mutation that creates a cryptic splice-donor site in GPR143 of patients with ocular albinism PMID:26061757
  13. The GPR143 gene analysis identified an identical point mutation in two Ocular albinism 1 patients and their mothers . PMID:24526317
  14. Melanosome-autonomous regulation of size and number: the OA1 receptor sustains PMEL expression. PMID:24650003
  15. OA1 is involved in melanoma cell migration and that OA1induced melanoma cell migration is mediated through the RAS/RAF/MEK/ERK signaling pathway. PMID:24736838
  16. a novel splicing site mutation of the GPR143 gene was found in a Han Chinese congenital ocular albinism pedigree. PMID:24301936
  17. Data report that p.Y269X mutation of GPR143 gene is responsible for the pathogenesis of familial ocular albinism. PMID:22916221
  18. Four patients with X-linked ocular albinism type 1 were identified from a cohort of 15 boys with clinical signs of albinism using mutation detection methods. PMID:22486324
  19. These results identify the Oa1 transducer Galphai3 as the first downstream component in the Oa1 signaling pathway. PMID:21931697
  20. The ocular albinism type 1 (OA1) GPCR is ubiquitinated and its traffic requires endosomal sorting complex responsible for transport (ESCRT) function. PMID:21730137
  21. TYR gene mutations have a more severe effect on pigmentation than mutations in OCA2 and the GPR143 gene. Nevertheless, mutations in these genes affect the development of visual function either directly or by interaction with other genes like MC1R. PMID:21541274
  22. A novel causative mutation of GPR143 was identified in a five-generation Chinese family with X-linked ocular albinism. PMID:21423867
  23. TYR gene mutations represent a relevant cause of oculocutaneous albinism in Italy, whereas mutations in P present a lower frequency. Clinical analysis revealed that the severity of the ocular manifestations depends on the degree of retinal pigmentation. PMID:20861488
  24. This is the first report of a Japanese X-linked ocular albinism (XLOA) patient with a GPR143 mutation. PMID:21348135
  25. L-DOPA activates GPR143 signaling through a Gq pathway, while dopamine inhibits the receptor. PMID:18828673
  26. we describe the first Spanish family known to present with X linked ocular albinism due to mutations in the OA1 gene PMID:20649618
  27. OA1 interacts with MART-1 at early stages of melanogenesis to control melanosome identity and composition. PMID:19717472
  28. Review: mutational analysis in ocular albinism type 1 PMID:11793467
  29. OA1 has been immunologically characterized as an antigen that is expressed, processed, and presented in an MHC-restricted fashion by melanoma cells, but for which there is the human equivalent of a "knockout"--i.e., complete deletion in a male patient. PMID:12538723
  30. Mutations in the OA1 gene is associated with ocular albinism PMID:12868035
  31. Mutational analysis of the OA1 ocular albinism gene. PMID:16646960
  32. No correlation was identified between congenital nystagmus and ocular albinism 1(OA1) gene. PMID:16754205
  33. Our results indicate that a mutation in the GPR143 gene can cause a variant form of ocular albinism, with congenital nystagmus as the most prominent and only consistent finding in all patients in this Chinese family. PMID:17516023
  34. eight new mutations located in the coding region of the gene are identified. PMID:17822861
  35. Two novel mutations in OA1 gene were identified in two families with ocular albinism. Identified mutations are likely loss-of-function mutations. Mutations in OA1 gene are associated with majority of X-linked ocular albinism cases. PMID:17960122
  36. These results indicate that this novel GPR143 mutation is associated with the congenital nystagmus observed in this Chinese family. PMID:18523664
  37. Panretinal function in OA1 is within normal limits at all ages, consistent with previous reports in generalized albinism. PMID:18798082
  38. Results illustrate an autocrine loop between OA1 and tyrosinase linked through L-DOPA, and this loop includes the secretion of at least one very potent retinal neurotrophic factor. PMID:18828673
  39. These results expand the mutation spectrum of GPR143, and demonstrate the clinical characteristics of OA1 among the Chinese. PMID:18978956
  40. The novel mutation p.G315X in the OA1 gene was identified in a Chinese family with ocular albinism, which is predicted to generate a premature stop codon. PMID:19123159
  41. Results suggest that this novel mutation in GPR143 is associated with the congenital nystagmus observed in this Chinese family. PMID:19390656
  42. Our results confirm that GPR143 is the major locus for X_linked ocular albinism and that exon 2 is a region of high susceptibility to deletions. PMID:19604113
  43. A Chinese family with X-linked ocular albinism and partial deletion of GPR143, is reported. PMID:19610097

Show More

Hide All

Subcellular Location
Melanosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor OA family
Tissue Specificity
Expressed at high levels in the retina, including the retinal pigment epithelium (RPE), and in melanocytes. Weak expression is observed in brain and adrenal gland.
Database Links

HGNC: 20145

UNIGENE: Hs.74124

KEGG: hsa:4935

STRING: 9606.ENSP00000417161

OMIM: 300500

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products