Recombinant Human Frizzled-9 (FZD9)

Code: CSB-CF009112HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6752

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

FZD9

Uniprot NO.

O00144

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

23-591

Target Protein Sequence

LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQY GCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARL PTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKF QYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQY PERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYY FGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGD ELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMKTGGTNTEKLE KLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGG SVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGSYG RGTHCHYKAPTVVLHMTKTDPSLENPTHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for WNT2 that is coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. Plays a role in neuromuscular junction (NMJ) assembly by negatively regulating the clustering of acetylcholine receptors (AChR) through the beta-catenin canonical signaling pathway. May play a role in neural progenitor cells (NPCs) viability through the beta-catenin canonical signaling pathway by negatively regulating cell cycle arrest leading to inhibition of neuron apoptotic process. During hippocampal development, regulates neuroblast proliferation and apoptotic cell death. Controls bone formation through non canonical Wnt signaling mediated via ISG15. Positively regulates bone regeneration through non canonical Wnt signaling.

Gene References into Functions

the present study indicated that the methylation profile of the FZD9 gene corresponded to that of a candidate tumorsuppressor gene in acute myeloid leukemia. PMID:27314612
The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and the frizzled-9/Wnt pathway is important in proliferation and differentiation. PMID:20458727
The activity of the Sprouty4 promoter is increased by Wnt7A/Fzd9 signaling through peroxisome proliferator-activated receptor gamma in lung cancer cells. PMID:20501643
The presence of nanog, Oct-4, SSEA-1, and SSEA-4 suggests that periodontal ligament mesenchymal stem cells are less differentiated than bone marrow-derived MSCs, and that the frizzled-9/Wnt pathway is important in proliferation and differentiation. PMID:20458727
transfection of Fzd-9 into a Wnt-7a-insensitive NSCLC cell line established Wnt-7a sensitivity PMID:15705594
Aberrant DNA methylation of frizzled 9 protein is associated with myelodysplastic syndrome progression to acute myeloid leukemia. PMID:18832655
SiRNA of frizzled-9 suppresses proliferation and motility of hepatoma cells. PMID:19724923

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor Fz/Smo family

Tissue Specificity

Expressed predominantly in adult and fetal brain, testis, eye, skeletal muscle and kidney. Moderately expressed in pancreas, thyroid, adrenal cortex, small intestine and stomach. Detected in fetal liver and kidney. Expressed in neural progenitor cells.

Database Links

HGNC: 4047

UNIGENE: Hs.647029

KEGG: hsa:8326

STRING: 9606.ENSP00000345785

OMIM: 601766

Promotions