QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKV QCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFP VHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPR QLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTV LTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTK KEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVK TITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRT IMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYA VPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGET AV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for Wnt proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activation by WNT8 induces expression of beta-catenin target genes. Following ligand activation, binds to CCDC88C/DAPLE which displaces DVL1 from FZD7 and leads to inhibition of canonical Wnt signaling, activation of G-proteins by CCDC88C and triggering of non-canonical Wnt responses. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.; (Microbial infection) Acts as a receptor for C.difficile toxin TcdB in the colonic epithelium.
Gene References into Functions
miR-504-meidated FZD7/Wnt/beta-catenin signaling pathway plays an important role in hepatocellular carcinoma development.PMID:30142536
High FZD7 expression is associated with Glioma.PMID:30010402
SOX8 bounds to the promoter region of FZD7 and induces the FZD7-mediated activation of the Wnt/beta-catenin pathway and confers chemoresistance and stemness properties and mediates epithelial mesenchymal transition in chemoresistant tongue squamous cell carcinoma.PMID:29071717
Frizzled 7 and phosphatidylinositol 4,5-diphosphate binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signaling.PMID:27386966
FZD7 may promote glioma cell proliferation via upregulation of TAZ.PMID:27852064
The miR-485-5p/FZD7 axis may provide novel insights into understanding the molecular pathogenesis of melanoma.PMID:28364602
FZD7 and IDH1 were assessed by immunohistochemistry in tissue microarrays.PMID:27409829
FZD7 transmits non-canonical Wnt signaling by interacting Wnt5A in the regulation of extracellular matrix expression.PMID:28736081
Silencing of FZD7 inhibits the growth, migration and invasion of esophageal squamous cell carcinoma cells. Silencing of FZD7 impedes the activation of Wnt signaling.PMID:28669726
Taken together, our study suggests that miR-542-3p inhibits HCC cell growth by targeting FZD7 and inhibiting Wnt signaling pathway. The decreased miR-542-3p expression may also contribute to the progression of HCC and may represent a novel molecular therapeutic target for HCC.PMID:27815069
Findings suggest that FZD7, involved in canonical Wnt signaling pathway, plays a critical role in mediating BMSCs-dependent protection of CML cells.PMID:26716419
Results found that FZD7 was highly upregulated by H. pylori infection and was associated with H. pylori infection-induced cell proliferation.PMID:26780940
This paper suggests that Fzd7 may act as one of the molecules that take part in the course of renal cell carcinoma formationPMID:26243397
FZD7 is a unique and nonredundant target of NOTCH3 in human breast epithelial cells.PMID:26847503
SNX27 inhibits the Wnt regulated transcription activity of TCF/LEF. Our results suggested that SNX27 interacts with Frizzled receptors to regulate the endocytosis and stability of FzdsPMID:26744382
Data show that cell proliferation and tumor growth decreased significantly after transfection with the plasmid frizzled 7 protein (FZD7)-Shiga-like toxin I (Stx1).PMID:26498690
FZD7 activated JNK in melanoma cell lines in vitro and the expression of a dominant negative JNK suppressed metastasis formation in vivo, suggesting that FZD7 may promote metastatic growth of melanoma cells via activation of JNKPMID:26808375
conclusion, our study suggests that miR-613 functions as a tumor suppressor, partially through targeting Fzd7, and is a potential therapeutic target for prostate cancer.PMID:26703210
High FZD7 expression is associated with cell migration, invasion, and epithelial-mesenchymal transition of cervical cancer.PMID:25740178
High expression of FZD7 is associated with cervical cancer.PMID:25976503
Frizzled 7 expression is positively regulated by SIRT1 and beta-catenin in breast cancer cells.PMID:24897117
Expression of FZD7 was inversely correlated with miR-199a in both hepatocellular carcinoma tissues and cells and over-expression of miR-199a significantly down-regulates the expression of genes downstream of FZD7.PMID:25313882
Knockdown of FZD7 in Stem-A subtype of ovarian cancer cells showed reduced cell proliferation with an increase in the G0/G1 sub-population.PMID:25032869
finding suggests that Wnt signaling is one of the factors of LSC niche, and Fz7 helps to maintain the undifferentiated state of LSCs.PMID:24170316
Data indicate that Wnt receptor Fzd7-dependent enhancement of Wnt signalling by DeltaNp63 governs tumour-initiating activity of the basal subtype of breast cancer.PMID:25241036
results demonstrate that FZD7 encodes a regulator of the pluripotent state and that hESCs require endogenous WNT/beta-catenin signaling through FZD7 to maintain an undifferentiated phenotypePMID:24474766
Our findings suggest that FZD7-involved canonical Wnt signaling pathway is essential for tumorigenesis of TNBC.PMID:21532620
Variable FZD7 expression in colorectal cancers indicates regulation by the tumour microenvironment.PMID:19655379
FZD7 plays a pivotal role in morphology transitions that are associated with colon tumor initiation and progression.PMID:15901282
During development, FZD7 orchestrates either migratory or epithelialization which implicate similar functional diversity for FZD7 during colorectal cancer devvelopment.PMID:17016432
These findings pinpoint calpain-1 as a regulator of Frizzled-7 turnover at the plasma membrane and reveal a link between Frizzled-7 cleavage and its activity.PMID:17716656
Syntenin stimulates c-jun phosphorylation and modulates Frizzled 7 signaling, in particular the PKCalpha/CDC42 noncanonical Wnt signaling cascade.PMID:18256285
FZD7-siRNA may be used as a therapeutic reagent for colorectal cancer.PMID:18592008
findings identify the WNT receptor FZD7 as a novel ES cell-specific surface antigen with a likely important role in the maintenance of ES cell self-renewal capacityPMID:18681827
FZD7 may be involved in enhancement of survival, invasion and metastatic capabilities of colon cancer cells through non-canonical Wnt signalling pathways as well as the canonical pathway.PMID:19773752
High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.