Recombinant Human Frizzled-7 (FZD7)

CSB-CF009110HU
Size:
20μg
20μg100μg
US$6550
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
FZD7
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
33-574
Target Protein Sequence
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKV QCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFP VHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPR QLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTV LTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTK KEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVK TITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRT IMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYA VPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGET AV
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for Wnt proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activation by WNT8 induces expression of beta-catenin target genes. Following ligand activation, binds to CCDC88C/DAPLE which displaces DVL1 from FZD7 and leads to inhibition of canonical Wnt signaling, activation of G-proteins by CCDC88C and triggering of non-canonical Wnt responses. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.; (Microbial infection) Acts as a receptor for C.difficile toxin TcdB in the colonic epithelium.
Gene References into Functions
  1. miR-504-meidated FZD7/Wnt/beta-catenin signaling pathway plays an important role in hepatocellular carcinoma development. PMID:30142536
  2. High FZD7 expression is associated with Glioma. PMID:30010402
  3. SOX8 bounds to the promoter region of FZD7 and induces the FZD7-mediated activation of the Wnt/beta-catenin pathway and confers chemoresistance and stemness properties and mediates epithelial mesenchymal transition in chemoresistant tongue squamous cell carcinoma. PMID:29071717
  4. Frizzled 7 and phosphatidylinositol 4,5-diphosphate binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signaling. PMID:27386966
  5. FZD7 may promote glioma cell proliferation via upregulation of TAZ. PMID:27852064
  6. The miR-485-5p/FZD7 axis may provide novel insights into understanding the molecular pathogenesis of melanoma. PMID:28364602
  7. FZD7 and IDH1 were assessed by immunohistochemistry in tissue microarrays. PMID:27409829
  8. FZD7 transmits non-canonical Wnt signaling by interacting Wnt5A in the regulation of extracellular matrix expression. PMID:28736081
  9. Silencing of FZD7 inhibits the growth, migration and invasion of esophageal squamous cell carcinoma cells. Silencing of FZD7 impedes the activation of Wnt signaling. PMID:28669726
  10. Taken together, our study suggests that miR-542-3p inhibits HCC cell growth by targeting FZD7 and inhibiting Wnt signaling pathway. The decreased miR-542-3p expression may also contribute to the progression of HCC and may represent a novel molecular therapeutic target for HCC. PMID:27815069
  11. Findings suggest that FZD7, involved in canonical Wnt signaling pathway, plays a critical role in mediating BMSCs-dependent protection of CML cells. PMID:26716419
  12. Results found that FZD7 was highly upregulated by H. pylori infection and was associated with H. pylori infection-induced cell proliferation. PMID:26780940
  13. This paper suggests that Fzd7 may act as one of the molecules that take part in the course of renal cell carcinoma formation PMID:26243397
  14. FZD7 is a unique and nonredundant target of NOTCH3 in human breast epithelial cells. PMID:26847503
  15. SNX27 inhibits the Wnt regulated transcription activity of TCF/LEF. Our results suggested that SNX27 interacts with Frizzled receptors to regulate the endocytosis and stability of Fzds PMID:26744382
  16. Data show that cell proliferation and tumor growth decreased significantly after transfection with the plasmid frizzled 7 protein (FZD7)-Shiga-like toxin I (Stx1). PMID:26498690
  17. FZD7 activated JNK in melanoma cell lines in vitro and the expression of a dominant negative JNK suppressed metastasis formation in vivo, suggesting that FZD7 may promote metastatic growth of melanoma cells via activation of JNK PMID:26808375
  18. conclusion, our study suggests that miR-613 functions as a tumor suppressor, partially through targeting Fzd7, and is a potential therapeutic target for prostate cancer. PMID:26703210
  19. High FZD7 expression is associated with cell migration, invasion, and epithelial-mesenchymal transition of cervical cancer. PMID:25740178
  20. High expression of FZD7 is associated with cervical cancer. PMID:25976503
  21. Frizzled 7 expression is positively regulated by SIRT1 and beta-catenin in breast cancer cells. PMID:24897117
  22. Expression of FZD7 was inversely correlated with miR-199a in both hepatocellular carcinoma tissues and cells and over-expression of miR-199a significantly down-regulates the expression of genes downstream of FZD7. PMID:25313882
  23. Knockdown of FZD7 in Stem-A subtype of ovarian cancer cells showed reduced cell proliferation with an increase in the G0/G1 sub-population. PMID:25032869
  24. finding suggests that Wnt signaling is one of the factors of LSC niche, and Fz7 helps to maintain the undifferentiated state of LSCs. PMID:24170316
  25. Data indicate that Wnt receptor Fzd7-dependent enhancement of Wnt signalling by DeltaNp63 governs tumour-initiating activity of the basal subtype of breast cancer. PMID:25241036
  26. results demonstrate that FZD7 encodes a regulator of the pluripotent state and that hESCs require endogenous WNT/beta-catenin signaling through FZD7 to maintain an undifferentiated phenotype PMID:24474766
  27. Our findings suggest that FZD7-involved canonical Wnt signaling pathway is essential for tumorigenesis of TNBC. PMID:21532620
  28. Variable FZD7 expression in colorectal cancers indicates regulation by the tumour microenvironment. PMID:19655379
  29. FZD7 plays a pivotal role in morphology transitions that are associated with colon tumor initiation and progression. PMID:15901282
  30. During development, FZD7 orchestrates either migratory or epithelialization which implicate similar functional diversity for FZD7 during colorectal cancer devvelopment. PMID:17016432
  31. These findings pinpoint calpain-1 as a regulator of Frizzled-7 turnover at the plasma membrane and reveal a link between Frizzled-7 cleavage and its activity. PMID:17716656
  32. Syntenin stimulates c-jun phosphorylation and modulates Frizzled 7 signaling, in particular the PKCalpha/CDC42 noncanonical Wnt signaling cascade. PMID:18256285
  33. FZD7-siRNA may be used as a therapeutic reagent for colorectal cancer. PMID:18592008
  34. findings identify the WNT receptor FZD7 as a novel ES cell-specific surface antigen with a likely important role in the maintenance of ES cell self-renewal capacity PMID:18681827
  35. FZD7 may be involved in enhancement of survival, invasion and metastatic capabilities of colon cancer cells through non-canonical Wnt signalling pathways as well as the canonical pathway. PMID:19773752

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor Fz/Smo family
Tissue Specificity
High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.
Database Links

HGNC: 4045

UNIGENE: Hs.173859

KEGG: hsa:8324

STRING: 9606.ENSP00000286201

OMIM: 603410

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products