Recombinant Human Frizzled-5 (FZD5)

Code: CSB-CF613403HU
Size:
20μg
20μg100μg
US$6677
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
FZD5
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
27-585
Target Protein Sequence
ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFL CSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVL CMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPL YNKVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRY PERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFG MASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPV AGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKL MIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLK YFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEASAALTGR TGPPGPAATYHKQVSLSHV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for Wnt proteins. Can activate WNT2, WNT10B, WNT5A, but not WNT2B or WNT4 (in vitro); the in vivo situation may be different since not all of these are known to be coexpressed. In neurons, activation of WNT7A promotes formation of synapses. Functions in the canonical Wnt/beta-catenin signaling pathway. The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable). Plays a role in yolk sac angiogenesis and in placental vascularization.
Gene References into Functions
  1. KLF9 suppressed tumorigenicity of the pancreatic ductal adenocarcinoma by negatively regulating frizzled-5. PMID:29621541
  2. miR-224 down-regulated the Wnt/beta-catenin signaling possibly by binding to Frizzled 5 and inhibited proliferation and migration of breast cancer cells PMID:27323393
  3. FZD5 is required for the growth of RNF43-mutant pancreatic ductal adenocarcinoma cells. PMID:27869803
  4. Long non-coding RNA FTH1P3 facilitates oral squamous cell carcinoma progression by regulating miR-224-5p and FZD5. PMID:28093311
  5. Novel frameshift mutation in FZD5 in a large, extended family was identified in which non-syndromic OC segregated as an autosomal dominant disorder. Functional analysis of the mutant protein, using zebrafish, mouse retinal explants and co-culture assays, strongly suggests a dominant-negative effect on WNT signaling, which is likely responsible for optic fissure closure defects. PMID:26908622
  6. restoring miR-124 may function as a promising strategy to overcome P-gp-mediated MDR by inhibiting FZD5/PKC signaling. PMID:25861751
  7. data (i) support previous the assumption that CK1 acts via phosphorylation of distinct residues as the activator as well as the shut-off signal of Wnt/beta-catenin signaling and (ii) suggest that CK1 acts on Dvl via different mechanism than Fzd5 PMID:24993822
  8. Gcm1 and Fzd5 function in an evolutionary conserved positive feedback loop that regulates trophoblast differentiation and sites of chorionic branching morphogenesis. PMID:23610556
  9. FZD5 was downregulated and reduced the synthesis of membrane transport protein in the hepatic membrane and the membrane stability, and accelerated the liver cell apoptosis process in alcoholic liver disease. PMID:23337955
  10. FZD5 cells did not differ between rheumatoid arthritis and osteoarthritis PMID:15338479
  11. We found that Dkk1-Fz5, but not Dkk3-Fz5, potently synergized with LRP6 to activate signaling in a dishevelled-dependent manner. PMID:15694380
  12. The Fz5 may be internalized through a clathrin-dependant pathway primarity when expressed in the absence of low-density lipoprotein receptor-related protein 6(LRP6). PMID:16890161
  13. POU5F1 and POU2F subfamily members play a pivotal role for the FZD5 expression in undifferentiated human ES cells, fetal liver/spleen, adult colon, pancreatic islet, and diffuse-type gastric cancer PMID:17273778
  14. Both Fz and Dvl functions are critical for Wnt-induced Lrp6 phosphorylation through Fz-Lrp6 interaction. Axin, a key scaffolding protein in the Wnt pathway, is required for Lrp6 phosphorylation via its ability to recruit Gsk3. PMID:18077588
  15. BAMBI interacts with Wnt receptor Frizzled5, coreceptor LRP6, and Dishevelled2 and increases the interaction between Frizzled5 and Dishevelled2 PMID:18838381
  16. Studies identify CVAK104 as a novel binding partner of Dishevelled (Dvl) and that CVAK104 also interacts with Fzd5. PMID:19643732

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell junction, synapse. Perikaryon. Cell projection, dendrite. Cell projection, axon.
Protein Families
G-protein coupled receptor Fz/Smo family
Database Links

HGNC: 4043

UNIGENE: Hs.17631

KEGG: hsa:7855

STRING: 9606.ENSP00000354607

OMIM: 601723

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products