QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Gene References into Functions
This study demonstrated a new approach using a combination of EpCAM and FRalpha as CTC-capture targets to increase the sensitivity of CTC detection in NSCLC efficiently, specifically, and quickly.PMID:29352248
Functions of EpCAM in physiological processes and diseases (Review).PMID:30015855
Our results suggest that GA733-2-Fc conjugated to ER-retention motif KDEL is a more efficient antigen to prevent tumor growth induced by colorectal carcinoma and minimize an allergic response.PMID:30249898
extracellular vesicles tend to localize in the intestinal tract associated with epithelial cell adhesion moleculePMID:27721471
Overexpression of EpCAM and melan-A is associated with malignant melanoma.PMID:29076925
Quercetin suppressed breast cancer stem cell proliferation, self-renewal, and invasiveness. It also lowered the expression levels of proteins related to tumorigenesis and cancer progression, such as aldehyde dehydrogenase 1A1, C-X-C chemokine receptor type 4, mucin 1, and epithelial cell adhesion molecules.PMID:29353288
Adenocarcinomas showed significantly higher staining scores of both VEGF and alphaSMA than squamous cell carcinomas did. In 42 cases of high CD31 score, five-year survival rate (87%) of patients with lung cancer showing mature tumor vessels was significantly better than that (69%) of patients with immature tumor vesselsPMID:29970536
New EPCAM founder deletion causing Lynch Syndrome has been described in Polish population.PMID:28369810
The novel and updated insights in the EpCAM field by simplifying the understanding of the biological role of this fascinating molecule, and by showing the promising therapeutic tools that have been developed by various approaches which use antibodies and vaccines for different cancer types for the clear purpose of improving patient outcome. [review]PMID:29759567
This is the first demonstration that the low sensitivity of CellSearch(R) to detect circulating tumor cells in colorectal cancer patients is not due to the lack of EpCAMPMID:28604994
Findings indicate that epithelial cell adhesion molecule (EpCAM) can be used as an additional distinction-marker for cystic lesions of the sellar region.PMID:27431859
Data indicate that epithelial cell adhesion molecule (EpCAM) show high tumor distinctiveness.PMID:28820475
Low expressions of Oct4-EpCAM in IHC and CD133 in qPCR may reveal roles in gastric cancerPMID:27557490
EpCAM expression contributes to tumor resistance to chemotherapy in patients with ovarian cancer.PMID:28574829
The present findings suggest that Ep-CAM expression may be associated with CRC carcinogenesis, while the loss of Ep-CAM expression is correlated with the progression, metastasis, and poor prognosis of CRC. Ep-CAM expression may be a useful biomarker for the clinical diagnosis of CRC.PMID:28558958
the present study identified a positive correlation between EpCAM and COX-2 expression in breast cancer cell lines and tissue specimens. EpCAM and COX-2 were associated with the prognosis of breast cancer patients.PMID:28393249
CD133+ cells were genetically heterogeneous among patients without any defined profile compared to CD133-/EpCAM+ cells.PMID:28347289
Combining the targets E-cadherin, epithelial membrane antigen (EMA), human epidermal growth receptor type 2 (Her2/neu), carcinoembryonic antigen (CEA) resulted in nearly 100% detection of ductal ovarian metastases, whereas the combination of EMA, Her2/neu and epithelial cell adhesion molecule (EpCAM) was most suitable to detect lobular ovarian metastases.PMID:28327103
Whole-genome sequencing identified the homozygous intronic variant EPCAM c.556-14A>G, considered explanatory for the patient's intractable diarrhea and providing a diagnosis of congenital tufting enteropathy.PMID:28701297
Low EPCAM expression is associated with colorectal carcinoma.PMID:26528695
Our study provided clinical evidence for EpCAM intracellular domain as a predictor of cancer development in patients with oral dysplasia and recurrence in oral squamous cell carcinoma patientsPMID:27421772
Elevated epithelial cell adhesion molecule EpCAM (mRNA+) CTC and Treg/CD4(+) levels were associated with early recurrence of hepatocellular carcinoma (HCC), indicative of poor clinical outcome.PMID:27439521
Observations provide important insights into the regulation of EpCAM expression during EMT, demonstrate an unexpected role for EpCAM in the regulation of ERK and define a novel double-negative feedback loop between EpCAM and ERK that contributes to the regulation of EMT.PMID:28192403
This study shows the potential of an EpCAM specific NIR-fluorescent agent in combination with a clinically validated intraoperative imaging system to visualize various tumours during surgery.PMID:27842504
The studies identified the characteristics and function of EpCAM glycosylation sites on breast cancer cell adhesion.PMID:28315854
These results identify EpCAM as a substrate of matriptase and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that causes disease when it is dysregulated.PMID:28094766
The EpCAM aptamer conjugated NCS showed specificity to EpCAM-positive cells.PMID:28668853
Pseudomyxoma peritonei ubiquitously express CEA and EpCAM.PMID:27038681
relationship between EpCAM-regulated transcription and altered biophysical properties of cells that promoteepithelial-mesenchymal transition (EMT) in advanced endometrial cancer.PMID:27569206
used a next generation sequencing (NGS) approach. NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as indicated by the up-regulations of CXCR4, EpCAM, CD133, and CD44, at the mRNA and protein levelsPMID:28126340
These results indicate that adipocyte-secreted factors might regulate cancer stem cell behavior through several signaling molecules including c-Met, STAT3 and ERK1/2 and inhibition of these signaling pathways offer novel strategies in targeting the effect of adipose-derived cytokines in cancer.PMID:27131739
The meta-analysis demonstrated that the expression of EpCAM in the gastric cancer group was greater than that in the control group. Moreover, EpCAM overexpression was associated with larger tumour size, lymphnode metastasis and worse prognosis in gastric cancer. [review]PMID:28403178
expression of EpCAM(MT) is associated with a more aggressive phenotype and predicts poor survival in patients with colorectal cancer.PMID:26996277
Higher levels of epithelial cell adhesion molecule (EpCAM) in breast cancer may be associated with poor response to Neoadjuvant chemotherapy (NAC) via a potential chemoresistant effect.PMID:27041736
By monitoring the change of fluorescence signal, the target EpCAM protein could be detected sensitively and selectively with a linear detection range from 3nM to 54nM and limit of detection (LOD) around 450pM. In addition, this nanobiosensor has been successfully used for EpCAM-expressed breast cancer MCF-7 cell detectionPMID:27614683
EpCAM, CD44 and CD133 expression could be candidate markers for Barrett esophagus disease progressionPMID:28216140
These findings are important for a better understanding of epithelial cell adhesion molecule apoptosis regulation and suggest epithelial cell adhesion molecule as a potential target for the treatment of breast cancer.PMID:28349835
that epithelial cell adhesion molecule showed different expression pattern among salivary gland neoplasms and in different grades of mucoepidermoid carcinomasPMID:27649957
we concluded that the peptide could be a better supplement to the EpCAM antibody for capturing Circulating tumor cells (CTCs) in microfluidic system with broader spectrumPMID:27818051
This study presented a molecular characterization of congenital tufting enteropathy Italian patients, and identified three mutations in the EpCAM genePMID:26684320
EpCAM serves as a potential biomarker of prognostic significance that could be used to identify oral squamous cell carcinoma patients at high risk and to predict patient survivalPMID:26401964
Findings show that the EGF-like domain of EpCAM is cleaved off in cancer cells which have undergone epithelial-mesenchymal transition.PMID:26775583
Based on these results, it can be concluded that EpCAM is suitable for use as an EC biomarker, therapeutic target, and effective parameter for tumor transfer and prognosis evaluation by aptamer SYL3C stainingPMID:26687301
CHD4 was abundantly expressed in EpCAM(+) hepatocellular carcinoma with expression of hepatic stem cell markers and poor prognosis in two independent cohorts.PMID:26095183
Flow cytometry assay showed doxorubicin exposure decreased EpCAM positive cell quantities in three HCC cell lines. EpCAM siRNA knock-down attenuated cell mortality after doxorubicin exposurePMID:26984381
EpCAM based capture detects and recovers circulating tumor cells from all subtypes of breast cancer except those low claudin expression.PMID:26556851
Increased Expression of EPCAM mRNA is associated with Recurrence After Curative Resection of Hepatocellular Carcinoma.PMID:25791790
We revealed a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM, and interfering with EpCAM function may be a novel therapeutic strategy for treatment of MTA1-overexpressing lung carcinomaPMID:26698569
knockdown of EpCAM can inhibition breast cancer cell growth and metastasis via inhibition of the Ras/Raf/ERK signaling pathway and MMP-9PMID:26356670
Results indicate that the anti-epithelial cell adhesion molecule (EpCAM) monoclonal antibodie can potentially be used for cancer-targeted therapy.PMID:26317650
Show
More
Hide
All
Subcellular Location
Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.
Protein Families
EPCAM family
Tissue Specificity
Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal