Recombinant Human Epithelial cell adhesion molecule (EPCAM), partial (Active)

In Stock
Code: CSB-MP007717HU
Size:
20ug
20ug100ug1mg
US$102
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human EPCAM protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/mL can bind Anti-EPCAM recombinant antibody (CSB-RA007717MA2HU). The EC50 is 1.098-1.401 ng/mL.
②EPCAM Recombinant Monoclonal Antibody (CSB-RA007717MA2HU) captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
EPCAM
Uniprot NO.
Alternative Names
Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-265aa
Target Protein Sequence
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/ml can bind Anti-EPCAM recombinant antibody (CSB-RA007717MA2HU). The EC50 is 1.098-1.401 ng/mL.
  • Activity
    EPCAM Recombinant Monoclonal Antibody (CSB-RA007717MA2HU) captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description

Epithelial cell adhesion molecule plays a central role in homotypic cell–cell adhesion and has emerged as a critical biomarker and therapeutic target in epithelial cancers, making functional protein reagents essential for antibody development and tumor biology studies. This mammalian-expressed construct spanning residues 24–265 demonstrates robust binding activity with an EC50 of 1.098–1.401 ng/mL against a recombinant anti-EPCAM antibody in functional ELISA, and surface plasmon resonance analysis confirms high-affinity interaction with a binding constant of 0.742 nM. These quantitative binding metrics indicate that the protein retains native epitope presentation, providing a suitable basis for antibody validation, epitope mapping, and screening campaigns targeting EPCAM-expressing tumor cells. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, the preparation meets the quality thresholds commonly required for cell-based adhesion assays and tumor metastasis research where low endotoxin is critical for preserving physiological cell behavior.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Gene References into Functions
  1. This study demonstrated a new approach using a combination of EpCAM and FRalpha as CTC-capture targets to increase the sensitivity of CTC detection in NSCLC efficiently, specifically, and quickly. PMID:29352248
  2. Functions of EpCAM in physiological processes and diseases (Review). PMID:30015855
  3. Our results suggest that GA733-2-Fc conjugated to ER-retention motif KDEL is a more efficient antigen to prevent tumor growth induced by colorectal carcinoma and minimize an allergic response. PMID:30249898
  4. extracellular vesicles tend to localize in the intestinal tract associated with epithelial cell adhesion molecule PMID:27721471
  5. Overexpression of EpCAM and melan-A is associated with malignant melanoma. PMID:29076925
  6. Quercetin suppressed breast cancer stem cell proliferation, self-renewal, and invasiveness. It also lowered the expression levels of proteins related to tumorigenesis and cancer progression, such as aldehyde dehydrogenase 1A1, C-X-C chemokine receptor type 4, mucin 1, and epithelial cell adhesion molecules. PMID:29353288
  7. Adenocarcinomas showed significantly higher staining scores of both VEGF and alphaSMA than squamous cell carcinomas did. In 42 cases of high CD31 score, five-year survival rate (87%) of patients with lung cancer showing mature tumor vessels was significantly better than that (69%) of patients with immature tumor vessels PMID:29970536
  8. New EPCAM founder deletion causing Lynch Syndrome has been described in Polish population. PMID:28369810
  9. The novel and updated insights in the EpCAM field by simplifying the understanding of the biological role of this fascinating molecule, and by showing the promising therapeutic tools that have been developed by various approaches which use antibodies and vaccines for different cancer types for the clear purpose of improving patient outcome. [review] PMID:29759567
  10. This is the first demonstration that the low sensitivity of CellSearch(R) to detect circulating tumor cells in colorectal cancer patients is not due to the lack of EpCAM PMID:28604994
  11. Findings indicate that epithelial cell adhesion molecule (EpCAM) can be used as an additional distinction-marker for cystic lesions of the sellar region. PMID:27431859
  12. Data indicate that epithelial cell adhesion molecule (EpCAM) show high tumor distinctiveness. PMID:28820475
  13. Low expressions of Oct4-EpCAM in IHC and CD133 in qPCR may reveal roles in gastric cancer PMID:27557490
  14. EpCAM expression contributes to tumor resistance to chemotherapy in patients with ovarian cancer. PMID:28574829
  15. The present findings suggest that Ep-CAM expression may be associated with CRC carcinogenesis, while the loss of Ep-CAM expression is correlated with the progression, metastasis, and poor prognosis of CRC. Ep-CAM expression may be a useful biomarker for the clinical diagnosis of CRC. PMID:28558958
  16. the present study identified a positive correlation between EpCAM and COX-2 expression in breast cancer cell lines and tissue specimens. EpCAM and COX-2 were associated with the prognosis of breast cancer patients. PMID:28393249
  17. CD133+ cells were genetically heterogeneous among patients without any defined profile compared to CD133-/EpCAM+ cells. PMID:28347289
  18. Combining the targets E-cadherin, epithelial membrane antigen (EMA), human epidermal growth receptor type 2 (Her2/neu), carcinoembryonic antigen (CEA) resulted in nearly 100% detection of ductal ovarian metastases, whereas the combination of EMA, Her2/neu and epithelial cell adhesion molecule (EpCAM) was most suitable to detect lobular ovarian metastases. PMID:28327103
  19. Whole-genome sequencing identified the homozygous intronic variant EPCAM c.556-14A>G, considered explanatory for the patient's intractable diarrhea and providing a diagnosis of congenital tufting enteropathy. PMID:28701297
  20. Low EPCAM expression is associated with colorectal carcinoma. PMID:26528695
  21. Our study provided clinical evidence for EpCAM intracellular domain as a predictor of cancer development in patients with oral dysplasia and recurrence in oral squamous cell carcinoma patients PMID:27421772
  22. Elevated epithelial cell adhesion molecule EpCAM (mRNA+) CTC and Treg/CD4(+) levels were associated with early recurrence of hepatocellular carcinoma (HCC), indicative of poor clinical outcome. PMID:27439521
  23. Observations provide important insights into the regulation of EpCAM expression during EMT, demonstrate an unexpected role for EpCAM in the regulation of ERK and define a novel double-negative feedback loop between EpCAM and ERK that contributes to the regulation of EMT. PMID:28192403
  24. This study shows the potential of an EpCAM specific NIR-fluorescent agent in combination with a clinically validated intraoperative imaging system to visualize various tumours during surgery. PMID:27842504
  25. The studies identified the characteristics and function of EpCAM glycosylation sites on breast cancer cell adhesion. PMID:28315854
  26. These results identify EpCAM as a substrate of matriptase and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that causes disease when it is dysregulated. PMID:28094766
  27. The EpCAM aptamer conjugated NCS showed specificity to EpCAM-positive cells. PMID:28668853
  28. Pseudomyxoma peritonei ubiquitously express CEA and EpCAM. PMID:27038681
  29. relationship between EpCAM-regulated transcription and altered biophysical properties of cells that promoteepithelial-mesenchymal transition (EMT) in advanced endometrial cancer. PMID:27569206
  30. used a next generation sequencing (NGS) approach. NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as indicated by the up-regulations of CXCR4, EpCAM, CD133, and CD44, at the mRNA and protein levels PMID:28126340
  31. These results indicate that adipocyte-secreted factors might regulate cancer stem cell behavior through several signaling molecules including c-Met, STAT3 and ERK1/2 and inhibition of these signaling pathways offer novel strategies in targeting the effect of adipose-derived cytokines in cancer. PMID:27131739
  32. The meta-analysis demonstrated that the expression of EpCAM in the gastric cancer group was greater than that in the control group. Moreover, EpCAM overexpression was associated with larger tumour size, lymphnode metastasis and worse prognosis in gastric cancer. [review] PMID:28403178
  33. expression of EpCAM(MT) is associated with a more aggressive phenotype and predicts poor survival in patients with colorectal cancer. PMID:26996277
  34. Higher levels of epithelial cell adhesion molecule (EpCAM) in breast cancer may be associated with poor response to Neoadjuvant chemotherapy (NAC) via a potential chemoresistant effect. PMID:27041736
  35. By monitoring the change of fluorescence signal, the target EpCAM protein could be detected sensitively and selectively with a linear detection range from 3nM to 54nM and limit of detection (LOD) around 450pM. In addition, this nanobiosensor has been successfully used for EpCAM-expressed breast cancer MCF-7 cell detection PMID:27614683
  36. EpCAM, CD44 and CD133 expression could be candidate markers for Barrett esophagus disease progression PMID:28216140
  37. These findings are important for a better understanding of epithelial cell adhesion molecule apoptosis regulation and suggest epithelial cell adhesion molecule as a potential target for the treatment of breast cancer. PMID:28349835
  38. that epithelial cell adhesion molecule showed different expression pattern among salivary gland neoplasms and in different grades of mucoepidermoid carcinomas PMID:27649957
  39. we concluded that the peptide could be a better supplement to the EpCAM antibody for capturing Circulating tumor cells (CTCs) in microfluidic system with broader spectrum PMID:27818051
  40. This study presented a molecular characterization of congenital tufting enteropathy Italian patients, and identified three mutations in the EpCAM gene PMID:26684320
  41. EpCAM serves as a potential biomarker of prognostic significance that could be used to identify oral squamous cell carcinoma patients at high risk and to predict patient survival PMID:26401964
  42. Findings show that the EGF-like domain of EpCAM is cleaved off in cancer cells which have undergone epithelial-mesenchymal transition. PMID:26775583
  43. Based on these results, it can be concluded that EpCAM is suitable for use as an EC biomarker, therapeutic target, and effective parameter for tumor transfer and prognosis evaluation by aptamer SYL3C staining PMID:26687301
  44. CHD4 was abundantly expressed in EpCAM(+) hepatocellular carcinoma with expression of hepatic stem cell markers and poor prognosis in two independent cohorts. PMID:26095183
  45. Flow cytometry assay showed doxorubicin exposure decreased EpCAM positive cell quantities in three HCC cell lines. EpCAM siRNA knock-down attenuated cell mortality after doxorubicin exposure PMID:26984381
  46. EpCAM based capture detects and recovers circulating tumor cells from all subtypes of breast cancer except those low claudin expression. PMID:26556851
  47. Increased Expression of EPCAM mRNA is associated with Recurrence After Curative Resection of Hepatocellular Carcinoma. PMID:25791790
  48. We revealed a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM, and interfering with EpCAM function may be a novel therapeutic strategy for treatment of MTA1-overexpressing lung carcinoma PMID:26698569
  49. knockdown of EpCAM can inhibition breast cancer cell growth and metastasis via inhibition of the Ras/Raf/ERK signaling pathway and MMP-9 PMID:26356670
  50. Results indicate that the anti-epithelial cell adhesion molecule (EpCAM) monoclonal antibodie can potentially be used for cancer-targeted therapy. PMID:26317650

Show More

Hide All

Subcellular Location
Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.
Protein Families
EPCAM family
Tissue Specificity
Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal
Database Links

HGNC: 11529

UNIGENE: Hs.542050

KEGG: hsa:4072

STRING: 9606.ENSP00000263735

OMIM: 185535

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products