Abbreviation
Recombinant Human EPCAM protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/mL can bind Anti-EPCAM recombinant antibody (CSB-RA007717MA2HU). The EC50 is 1.098-1.401 ng/mL.
②EPCAM Recombinant Monoclonal Antibody (CSB-RA007717MA2HU) captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay (WeSPRTM 200).
Alternative Names
Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326
Species
Homo sapiens (Human)
Expression Region
24-265aa
Target Protein Sequence
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human EPCAM at 2 μg/ml can bind Anti-EPCAM recombinant antibody (CSB-RA007717MA2HU). The EC50 is 1.098-1.401 ng/mL.
-
Activity
EPCAM Recombinant Monoclonal Antibody (CSB-RA007717MA2HU) captured on Protein A Chip can bind Human EPCAM with an affinity constant of 0.742 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
Epithelial cell adhesion molecule plays a central role in homotypic cell–cell adhesion and has emerged as a critical biomarker and therapeutic target in epithelial cancers, making functional protein reagents essential for antibody development and tumor biology studies. This mammalian-expressed construct spanning residues 24–265 demonstrates robust binding activity with an EC50 of 1.098–1.401 ng/mL against a recombinant anti-EPCAM antibody in functional ELISA, and surface plasmon resonance analysis confirms high-affinity interaction with a binding constant of 0.742 nM. These quantitative binding metrics indicate that the protein retains native epitope presentation, providing a suitable basis for antibody validation, epitope mapping, and screening campaigns targeting EPCAM-expressing tumor cells. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, the preparation meets the quality thresholds commonly required for cell-based adhesion assays and tumor metastasis research where low endotoxin is critical for preserving physiological cell behavior.
