Home
Product
Protein
Transmembrane Proteins
Recombinant Human Endothelin B receptor-like protein 2 (GPR37L1)

Recombinant Human Endothelin B receptor-like protein 2 (GPR37L1)

Code: CSB-CF009811HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5907

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GPR37L1

Uniprot NO.

O60883

Alternative Names

GPR37L1; ETBRLP2; G-protein coupled receptor 37-like 1; Endothelin B receptor-like protein 2; ETBR-LP-2

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

26-481

Target Protein Sequence

APLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVAT SPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSAYAIMLLALVVFAVGI VGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVLFFCLPIVIFNEITKQRLLGDVSCRA VPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVRPIERCQSILAKLAVIWVGSMTLAVP ELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYSLVMTYQNARMWWYFGCYFCLPILFT VTCQLVTWRVRGPPGRKSECRASKHEQCESQLNSTVVGLTVVYAFCTLPENVCNIVVAYL STELTRQTLDLLGLINQFSTFFKGAITPVLLLCICRPLGQAFLDCCCCCCCEECGGASEA SAANGSDNKLKTEVSSSIYFHKPRESPPLLPLGTPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

G-protein coupled receptor. Has been shown to bind the neuroprotective and glioprotective factor prosaposin (PSAP), leading to endocytosis followed by an ERK phosphorylation cascade. However, other studies have shown that prosaposin does not increase activity. It has been suggested that GPR37L1 is a constitutively active receptor which signals through the guanine nucleotide-binding protein G(s) subunit alpha. Participates in the regulation of postnatal cerebellar development by modulating the Shh pathway. Regulates baseline blood pressure in females and protects against cardiovascular stress in males. Mediates inhibition of astrocyte glutamate transporters and reduction in neuronal N-methyl-D-aspartate receptor activity.

Gene References into Functions

These findings provide evidence linking GPR37L1 and GPR37 to seizure etiology and demonstrate an association between a homozygous variant in GPR37L1 (c.1047G>T [Lys349Asn]) and a novel progressive myoclonus epilepsy. PMID:28688853
Data show that G protein (heterotrimeric guanine nucleotide-binding protein)-coupled receptor (GPR37L1) coupled to the G protein Galpha(s) when heterologously expressed in cultured cells. PMID:27072655
GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin. PMID:23690594

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell projection, cilium membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in primary cortical astrocytes (at protein level). Expressed in the central nervous system.

Database Links

HGNC: 14923

UNIGENE: Hs.132049

KEGG: hsa:9283

STRING: 9606.ENSP00000356251