Recombinant Human Endothelin-1 receptor (EDNRA)-VLPs (Active)

In Stock
Code: CSB-MP007403HU
Size:
20ug
20ug100ug1mg
US$558
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human EDNRA protein-VLPs (Active)
Purity
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human EDNRA at 10 μg/mL can bind Anti-EDNRA recombinant antibody(CSB-RA007403MA3HU). The EC50 is 2.225-3.570 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
EDNRA
Uniprot NO.
Research Area
Signal Transduction
Alternative Names
Endothelin-1 receptor; Endothelin receptor type A; EDNRA; ETA, ETRA
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-427aa
Target Protein Sequence
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 0.2 M Arginine, 6% Trehalose
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • CSB-MP007403HU is detected by Mouse anti-6*His monoclonal antibody.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human EDNRA at 10 μg/ml can bind Anti-EDNRA recombinant antibody(CSB-RA007403MA3HU). The EC50 is 2.225-3.570 ng/mL.The VLPs (CSB-MP3838) is negative control.
  • The purity of VLPs was greater than 95% as determined by SEC-HPLC
Description

Endothelin-1 receptor type A mediates vasoconstriction and smooth muscle proliferation in cardiovascular physiology, making it a critical target for hypertension and heart failure research. This full-length mature protein (aa 21–427) is presented in virus-like particles that preserve native membrane topology and conformational epitopes, enabling functional antibody binding assays with an EC50 of 2.225–3.570 ng/mL when tested against a recombinant anti-EDNRA antibody in ELISA format. The quantified binding activity supports use in competitive inhibition screens, therapeutic antibody epitope mapping, and blocking antibody validation studies where receptor conformation directly influences epitope accessibility. Endotoxin levels below 1.0 EU/μg align with standards expected in cell-based assays and antibody characterization workflows that require low inflammatory background.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.
Gene References into Functions
  1. No link between EDNRA rs5335 and large artery stroke risk in a Ukrainian population was found. PMID:29849817
  2. miR200c regulates the proliferation, apoptosis and invasion of gastric carcinoma cells through the downregulation of EDNRA expression. PMID:29286062
  3. Presence of SST5, CXCR4 and ETA on tumor cells and of SST3, CXCR4 and ETA on microvessels gradually increased from grade II to grade IV tumors. PMID:29696364
  4. There is no association between the C+70G polymorphism of the EDNRA gene and the development of ischemic atherothrombotic stroke. PMID:29064794
  5. endothelin-A receptor-activated ABCB1 expression has a role in nintedanib resistance in FGFR1-driven small cell lung cancer PMID:27367030
  6. Endothelin-1 possesses an anti-apoptotic effect in vascular endothelial cells and this effect is mediated, to a great extent, via the activation of EDNRB, with a minor contribution via activation of EDNRA. PMID:28732172
  7. ETA and ETB receptors are present in human haemorrhoids with ETB receptors predominating PMID:28095606
  8. ETAR stimulation acted via downstream G-protein Galphaq/11 and Rho GTPase to suppress the Hippo pathway, thus leading to YAP/TAZ activation, which was required for ETAR-induced tumorigenesis. Overall, these results indicate a critical role of the YAP/TAZ axis in ETAR signaling PMID:28249901
  9. Data show that endothelin A receptor drives invadopodia function by direct interaction of beta-arrestin-1 (beta-arr1) with Rho guanine nucleotide exchange factor (GEF) 11 protein (PDZ-RhoGEF). PMID:26522724
  10. In control arteries, ETAR was expressed by vascular smooth muscle cells in the media whereas ETBR was hardly detected. In giant cell arteritis, both ETAR and ETBR receptors were expressed by alphaSMA-positive cells at the intima-media border. Endothelial cells and inflammatory cells also expressed both ET receptors. PMID:28606962
  11. Data suggest that TNFalpha (tumor necrosis factor-alpha) induces proliferation of airway smooth muscle cells via ET1 (endothelin-1), GM-CSF (granulocyte-macrophage colony-stimulating factor), and IL6 (interleukin 6) signaling; ET1 induces cell proliferation via ETAR (endothelin receptor type A); ETBR (endothelin receptor type B) is up-regulated by TNFalpha and appears to mediate ET1 effects on cell proliferation. PMID:27422754
  12. presence of ET-1 receptors in the chronic thrombus in proximal CTEPH suggests ET-1 could act not only on the distal vasculopathy in the unobstructed vessels but may also stimulate smooth muscle cell proliferation within chronic clot PMID:26874031
  13. Data show that auriculo-condylar syndrome (ACS)-associated mutations in G protein subunit alpha i3 (GNAI3) produce dominant-negative Galpha(i3) mutant proteins that couple to endothelin type A receptor (ET(A)R). PMID:27072656
  14. Patients with lung fibrosis and patients with high modified Rodnan skin score showed a reduced endothelin 1 Type A receptor (ETAR)/ETBR ratio. PMID:26773103
  15. High ETAR expression is associated with ovarian carcinoma. PMID:26675258
  16. Data show that macitentan interferes with the profibrotic action of transforming growth factor-beta (TGF-beta), blocking the endothelin receptor type A (ET-1 receptor) portion of the ET-1/TGF-beta receptor complex. PMID:26357964
  17. Ednra, encoding Endothelin receptor A (ETA)-the target of Endothelin 1 (ET-1)-was significantly increased in Systemic Capillary Leak Syndrome blood-outgrowth endothelial cells compared to healthy controls. PMID:26176954
  18. Genebased analyses revealed associations of the EDNRA gene with longitudinal Blood Pressure phenotypes, associations with essential hypertension, Blood Pressure salt sensitivity, preeclampsia, or preclinical stages of atherosclerosis. PMID:25424718
  19. Endothelin receptor A was detected in all patients with squamous cell carcinoma and psoriasis, with a higher frequency and grade of expression than controls and basal cell carcinoma. PMID:25946671
  20. The aim was to quantify the density of ETA and ETB receptors in cardiopulmonary tissue from pulmonary arterial hypertension patients and the monocrotaline (MCT) rat. PMID:24582810
  21. findings suggest a role for agonistic autoantibodies-induced activation of immune cells mediated by the AT1R and the ETAR in the pathogenesis or even the onset of systemic sclerosis PMID:24612997
  22. Polymorphisms of EDNRA have been associated with the development of group I pulmonary hypertension, dilated cardiomyopathy and essential hypertension PMID:24570333
  23. Mutations in the endothelin receptor type A cause mandibulofacial dysostosis with alopecia. PMID:25772936
  24. significant single nucleotide polymorphism associations with birth weight near coding regions for two genes involved in oxygen sensing and vascular control, PRKAA1 and EDNRA, respectively, were identified. PMID:25225183
  25. no significant association between EDNRA (C+70G, G-231A) allele and Hashimoto's thyroiditis in Turkish population; this polymorphism relates to decreased risk for early disease onset PMID:24815860
  26. Data show that upon endothelin-1 (ET-1) stimulation, ET type A receptor (ETAR) is recycled back to plasma membrane, whereas ET type B receptor (ETAR) is targeted to lysosome for degradation. PMID:25381251
  27. Suggest a functional link between endothelin receptor autoantibody formation and down-regulated midkine serum levels, that may be relevant in the pathogenesis of clinically relevant peripheral artery occlusive disease. PMID:25056169
  28. genetic association study in population in India: Data suggest that (in addition to mutations in cystic fibrosis transmembrane conductance regulator) an SNP in EDNRA (rs5335) is associated with congenital absence of vas deferens in population studied. PMID:24958810
  29. our findings reveal the existence of a novel mechanism by which ETAR/beta-arr1 signaling is integrated with the Wnt/beta-catenin pathway to sustain chemoresistance in epithelial ovarian cancer, and they offer a solid rationale for clinical evaluation PMID:25377471
  30. no association between Graves' disease and genetic polymorphism PMID:24291390
  31. EDNRA mRNA expression was increased in reflux esophagitis and Barrett's esophagus compared to controls. PMID:23384184
  32. ETAR and CXCR4 expression levels are potential prognostic biomarkers in nasopharyngeal carcinoma patients. PMID:23987636
  33. Mutation of EDNRA is involved in ACTH-independent macronodular adrenal hyperplasia. PMID:23754170
  34. We used this sample of 250 surgical patients to describe the distribution of ET-1, ETA and ETB polymorphisms in the aneurysmal subarachnoid hemorrhage population. PMID:22997346
  35. ETAR overexpression promoted colon cancer liver metastases. PMID:23818293
  36. Report serum levels ETAR autoantibodies in peripheral arterial disease. PMID:24627317
  37. the positive correlation between ET-1 and ETAR in lesional compared with perilesional normal epidermis suggest an important role of this receptor in vitiligo. PMID:23683481
  38. Desensitization and internalization of endothelin receptor A: impact of G protein-coupled receptor kinase 2 (GRK2)-mediated phosphorylation. PMID:24064210
  39. The presence ETr-A and ETr-B in rheumatic mitral valves suggests its interaction with the system of c endothelins, particularly ETr-B detected in a greater proportion, which could explain the lack of expression of endothelin in rheumatic mitral valve. PMID:23515723
  40. Genetic deletion of a nephron-specific endothelin A receptor causes very modest fluid retention that does not alter arterial pressure, nor doea it play a major role in regulating sodium excretion or systemic hemodynamics. PMID:23217151
  41. The mRNA expressions of endothelin A and B receptors and endothelin-1 are significantly increased in failed Fontan patients. PMID:21356562
  42. A significant difference existed between migraineurs & controls with AA genotype vs. AG+GG. Pooled relative risk with fixed effect was 4.04. This meta-analysis suggests a significant association between EDNRA -231G>A polymorphism and migraine. PMID:23058564
  43. Right ventricular hypertrophy myocardial endothelin type A receptor level is increased compared to nonhypertrophied right ventricular endothelin receptor level. PMID:23233754
  44. Findings suggest a potential link between specific genotypes in the ednra gene and susceptibility to pulmonary arterial hypertension. PMID:21773759
  45. Both endothelin A and B receptors were reduced in pulmonary arterial hypertension, particularly type B, and type B signaling through protein kinases was markedly reduced in vascular smooth cells with a mutation in bone morphogenetic protein receptor 2. PMID:22688668
  46. endothelin A receptor and epidermal growth factor receptor signaling converge on beta-catenin to promote ovarian cancer metastasis PMID:22480520
  47. ETB receptors predominated in normal human liver and displayed the highest ratio (ETB:ETA 63:47) compared with other peripheral tissues; liver ETB expression was upregulated in cirrhosis (ETB:ETA 83:17) PMID:22365955
  48. Expressed recombinant ET(A) as a fusion protein with phi6 p9 envelope protein. The purified protein showed specific binding to ET-1 and the alpha subunit of G(q) protein. PMID:22561246
  49. SNP, rs6842241, near EDNRA at chromosome 4q31.22 (combined P-value = 9.58 x 10(-9); odds ratio = 1.25), was found to be significantly associated with intracranial aneurysm PMID:22286173
  50. Data show that optical imaging with a fluorescent ET(A)R tracer allows the noninvasive imaging of tumor-associated ET(A)R expression in vivo. PMID:22510270

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRA sub-subfamily
Tissue Specificity
Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and li
Database Links

HGNC: 3179

UNIGENE: Hs.183713

KEGG: hsa:1909

STRING: 9606.ENSP00000315011

OMIM: 131243

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products