Abbreviation
Recombinant Human EDNRA protein-VLPs (Active)
Purity
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human EDNRA at 10 μg/mL can bind Anti-EDNRA recombinant antibody(CSB-RA007403MA3HU). The EC50 is 2.225-3.570 ng/mL.The VLPs (CSB-MP3838) is negative control.
Research Area
Signal Transduction
Alternative Names
Endothelin-1 receptor; Endothelin receptor type A; EDNRA; ETA, ETRA
Species
Homo sapiens (Human)
Expression Region
21-427aa
Target Protein Sequence
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 0.2 M Arginine, 6% Trehalose
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
CSB-MP007403HU is detected by Mouse anti-6*His monoclonal antibody.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human EDNRA at 10 μg/ml can bind Anti-EDNRA recombinant antibody(CSB-RA007403MA3HU). The EC50 is 2.225-3.570 ng/mL.The VLPs (CSB-MP3838) is negative control.
-
The purity of VLPs was greater than 95% as determined by SEC-HPLC
Description
Endothelin-1 receptor type A mediates vasoconstriction and smooth muscle proliferation in cardiovascular physiology, making it a critical target for hypertension and heart failure research. This full-length mature protein (aa 21–427) is presented in virus-like particles that preserve native membrane topology and conformational epitopes, enabling functional antibody binding assays with an EC50 of 2.225–3.570 ng/mL when tested against a recombinant anti-EDNRA antibody in ELISA format. The quantified binding activity supports use in competitive inhibition screens, therapeutic antibody epitope mapping, and blocking antibody validation studies where receptor conformation directly influences epitope accessibility. Endotoxin levels below 1.0 EU/μg align with standards expected in cell-based assays and antibody characterization workflows that require low inflammatory background.