Home
Product
Protein
Transmembrane Proteins
Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 3 (EMR3)

Recombinant Human EGF-like module-containing mucin-like hormone receptor-like 3 (EMR3)

Code: CSB-CF861168HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4844

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ADGRE3

Uniprot NO.

Q9BY15

Alternative Names

ADGRE3; EMR3; UNQ683/PRO1562; Adhesion G protein-coupled receptor E3; EGF-like module receptor 3; EGF-like module-containing mucin-like hormone receptor-like 3

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

339-652

Target Protein Sequence

SSFAVLMALTSQEEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLC LFLAHLLFLVGIDRTEPKVLCSIIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSS INRLMKWIMFPVGYGVPAVTVAISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSA NLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQV MAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKP SEGDVFPGQVKRKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Orphan receptor that may play a role myeloid-myeloid interactions during immune and inflammatory responses. A ligand for the soluble form of this receptor is present at the surface of monocytes-derived macrophages and activated neutrophils.

Gene References into Functions

Given the poor survival associated with high levels of EMR-3 expression in glioma patients, impetus is provided to explore EMR-3 as a potential therapeutic target. PMID:20827226
Additional transcription changes likely associated with Th2-like eosinophilic inflammation were prominent and included increased EMR1&3. PMID:20625511
The expression of EGF-TM7 receptors on myeloid cells is differentially regulated. EMR3 is the first family member found mainly on granulocytes. PMID:17108056

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.; [Isoform 3]: Secreted.

Protein Families

G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily

Tissue Specificity

Displays a predominantly leukocyte-restricted expression, with highest levels in neutrophils, monocytes and macrophages.

Database Links

HGNC: 23647

UNIGENE: Hs.658712

KEGG: hsa:84658

STRING: 9606.ENSP00000253673