Can you produce proteins CSB-CF892171HU(A4) and CSB-MP892171HU(A4) in a mass spectrometry compatible form (i.e. No glycerol or incompatible detergents)?
We can provide you the human SLC7A11 protein without glycerol or incompatible detergents.
Recombinant Human Cystine/glutamate transporter(SLC7A11),Nanodiscs
CSB-CF892171HU(A4)-N >> in vitro E.coli expression system $1852.5/100ug+$333 $1181/20ug+$333 delivery time: 18-28 working days
Expression region: 1-501aa;full-length protein
Tag sequence: N-terminal 10xHis-tagged;
Target protein sequence:
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
If nanodisc assembly fails, we can provide DDM detergent fusion protein and only charge the cost of the fusion protein. If DDM fails again and there is no other compatible detergent, it will be treated as a failure and a cost of $540 will be charged.
Email: support@cusabio.com
Distributors Worldwide