MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for cysteinyl leukotrienes. The response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veins and might also have an indirect role in the relaxation of the pulmonary vascular endothelium. The rank order of affinities for the leukotrienes is LTC4 = LTD4 >> LTE4.
Gene References into Functions
Its mutation is found in patients with meningeal melanocytic tumour.PMID:29476293
our study identifies CYSLTR2 L129Q alterations as a previously unrecognized activating mutation in blue nevi, occuring in a mutually exclusive fashion with known GNAQ and GNA11 mutations.PMID:27934878
The expression of CysLTR1 and CysLTR2 is higher in the lymphocytes of hyperplasic tonsils in nonallergic childrenPMID:27221082
findings implicate CYSLTR2 as a uveal melanoma oncogene and highlight the critical role of Galphaq signaling in uveal melanoma pathogenesisPMID:27089179
CysLTRs -1 and -2 seem to be involved in lymphocyte maturation that occurs in tonsils, without influence of allergies.PMID:27115897
CysLT2 receptors were expressed in lung specimens isolated from asthma subjects. Activation of CysLT2 receptors may contribute to antigen-induced bronchoconstriction in certain asthma population.PMID:26433531
Autocrine activity of cysteinyl leukotrienes in human vascular endothelial cells: Signaling through the CysLT receptorPMID:25839425
CysLTR-1 and CysLTR-2 are highly expressed in the adenoid tissues from children with AH, suggesting that leukotrienes are involved in the pathogenesis of AH.PMID:25760841
Suggest that endothelial and nonendothelial CysLT2R niches have separate roles in mediating inflammatory responses in ischemic/perfusion injury.PMID:24285579
ATRA treatment induces CysLT(2)R mRNA and protein expression in colon cancer cell linesPMID:23829413
CysLT2 receptor plays a primary role in the vascular responses in the upper respiratory tract.PMID:23524649
increased expression in tonsillar tissues of Chinese children with sleep-disordered breathingPMID:22634478
There is a protective role against tumor progression for CysLT(2)R and that it highlights new possibilities to regulate the CysLT(2)R.PMID:22194989
The synthesis of cys-LTs from LTA(4) by endothelial cells is directly associated with the activation of the CysLT(2) receptor in a typical autocrine fashion.PMID:21753081
Cysteinyl leukotriene receptor 2 gene polymorphism -1220 A/C is not associated with atopic dermatitis or psoriasis vulgaris in Japanese patients.PMID:21352274
upon ligand activation, CysLT(1)R is tyrosine-phosphorylated and released from heterodimers with CysLT(2)R and, subsequently, internalizes from the plasma membrane to the nuclear membrane in a clathrin-, arrestin-3-, and Rab-5-dependent mannerPMID:21203429
results indicate that the M201V polymorphism drastically affects CysLT(2) responses to LTD(4) and less to LTC(4)PMID:20966037
Data show functional expression of CysLT1 and 2 receptors on human platelets and demonstrate that CysLTs induced the release of significant amounts of RANTES, which suggests a novel role for human platelets in CysLT-mediated allergic inflammation.PMID:20433311
Ca2+ fluxes elicited by CysLT in these vascular endothelial cells emanate from perturbation of the CysLT2R, rather than the expected CysLT1R.PMID:12816881
mast cells express the type 2 receptor for cysLTs (CysLT2R) as well, and that the amount of surface CysLT2R protein increases in response to priming with IL-4PMID:13679572
Mutations in cysteinyl leukotriene 2 receptor is associated with atopyPMID:14515063
identified three novel exons in the 5' untranslated region of CYSLTR2 and eight novel polymorphisms; the -1220A > C polymorphism is associated with the development of asthmaPMID:15454733
601A>G coding polymorphism in the CYSLT2 receptor alters the potency of LTD4PMID:15475736
Endothelial CysLT2R increases vascular permeability & recruits neutrophils via enhanced P-selectin expression. It may participate in hypotensive anaphylaxis. CysLT2R-dependent NO formation interacts with superoxide to form peroxynitrite.PMID:15545522
CysLT 1 expression predominates on inflammatory leukocytes in aspirin-sensitive rhinosinusitis. Effects of cysteinyl leukotrienes on glands and epithelium may be mediated predominantly through cysLT 2. Potentially important therapeutic implications.PMID:15696087
Because LTD4 and thrombin are likely to be formed concomitantly in vivo, cysLT2-R and PAR-1 may cooperate to augment vascular injury.PMID:16606835
CYSLTR2 and ALOX5 polymorphisms may predispose a minority of individuals to excessive cysteinyl-leukotriene concentrations, yielding a distinct asthma phenotype most likely to respond to leukotriene modifier pharmacotherapy.PMID:17460547
CysLT1R and CysLT2R expression in monocytes can be regulated by CysLT itself and T(H)2 cytokines at the transcriptional level.PMID:17941281
Since prostacyclin is a major blood vessel-protective and anti-thrombotic eicosanoid, the EC cysLT(2)-R may limit its otherwise pro-inflammatory actions through a protective Ca(2+)/calcineurin/NFAT-dependent COX-2 feedback loopPMID:17991613
the potential implication of CysLT2 in the inflammatory response through the modulation of chemokine gene transcription.PMID:18048362
Our results reveal that CysLT(2)R can mediate inflammatory reactions in a vascular bed-specific manner by altering transendothelial vesicle transport-based vascular permeability.PMID:18779380
increase in urinary levels is associated with anaphylaxies and eosinophilic pneumoniaPMID:18946233
The sequence variants of CysLTR2 may affect its transcription and the stability of its mRNA, resulting in altered expression of CysLTR2 protein, which in turn causes some asthmatics to be susceptible to aspirin hypersensitivityPMID:19840403
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed, with highest levels in the heart, placenta, spleen, peripheral blood leukocytes and adrenal gland. In lung, expressed in the interstitial macrophages, and slightly in smooth muscle cells.