MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH MSASVPPQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
CCK1R may play a role differing from CCK2R in colon carcinogenesis, nuclear CCK1R represents a potential biomarker for poor prognosis.PMID:26508021
Study shows downregulation of CCKAR gene expression in A1/A1 genotype of gallstone disease patients as compared with control with significant variation in its expression pattern in relation to polymorphism.PMID:27287528
Our study showed significantly higher expression of CCKAR and down regulation of CCKBR in pancreatic cancer as compared to control while CCKBR/GR was detected in majority of stomach cancer samples. Thus, our study suggests that CCK and Gs receptors may have diagnostic and therapeutic implications.PMID:27072272
The neurotransmitter cholecystokinin (CCK), along with its receptors, CCKAR and CCKBR, have been previously associated with psychiatric disorders, suggesting that variants near these genes may play a role in the pre-pulse/startle response in this cohortPMID:26608796
CCK-AR polymorphism is protective against functional dyspepsia.PMID:26551933
There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.PMID:25875176
Age related differential expression of CCKAR in GBC may suggest two possible variants of the disease in this endemic belt.PMID:25025063
Y140A mutation within a cholesterol-binding motif results in ligand binding and activity characteristics similar to wild type CCK1R. in a high cholesterol environmentPMID:24825903
The findings suggest that variants in the CCKAR gene may influence the risk of gallbladder cancer in women.PMID:23701593
A significant association of the cholecystokinin-A receptor (CCKAR) gene variation rs1800857 and language lateralization, is reported.PMID:23341962
The results showed that three individual haplotypes of CCKAR were strongly associated with increased risk of schizophrenia.PMID:22825913
Data suggest that CCK-1R expression is up-regulated in kidney tubules (but not in glomeruli) in patients with diabetic nephropathy; increased expression of CCK-1R in tubules appears to be biomarker of severity of proteinuria in these patients.PMID:22396142
data may suggest that the TM3 CRAC cholesterol-binding motif could be responsible for the cholesterol sensitivity of the CCK1R.PMID:22021636
CCKAR expression was significantly increased in gallbladder cancer compared to gallstone disease.PMID:21813391
Data indicate that the Homo-Phe derivative 2 (VL-0797) enhanced 12-fold the affinity for the rat CCK(1)-R affinity and 15-fold for the human CCK(1)-R relative to the reference compound 12 (VL-0395).PMID:21728335
An association is not found between cholecystokinin A receptor polymorphisms and antipsychotic induced weight gain in schizophrenia patients.PMID:20732371
LPS can up-regulate the expression of CCK-AR and CCK-BR mRNA in vascular endothelial cells.PMID:19751565
a 2-marker haplotype (rs1800855/rs1800857) in the CCKAR gene protected women against PD (P=0.004). In addition, we found two novel rare missense variations in the CCKBR gene (Lys329Asn and Pro446Leu) in two and one patient, respectivelyPMID:20023595
an intron 1 polymorphism in the cholecystokinin A receptor gene is associated with schizophrenia in malesPMID:19753663
Significant association between polymorphism at the -85 locus of the CCKAR gene in patients with hallucination, especially patients with hallucination in delirium tremens.PMID:12198366
the presence of CCK receptors in human ductal pancreatic tumor samples is mainly due to CCK2 expression in residual pancreatic islets and CCK1 in pancreatic nerves.PMID:12851875
heterodimerization of type A and B cholecystokinin receptors forms a powerful signaling unit with potential clinical significance in promoting cell growthPMID:14534299
In this review, both localization and functional studies suggest that the motor effects of cholecystokinin are mediated by CCK1/CCKA receptors in humans.PMID:15100163
CCK-AR gene polymorphism may be involved in the neurobiology of panic disorder.PMID:15108185
CCK-AR gene is suggested to predispose persons to schizophrenia.PMID:15363473
analysis of partial and full agonism mediated by the human cholecystokinin-1 receptorPMID:15632187
Finds significant differences in intelligence for Cholecystokinin A receptor gene promoter polymorphisms A-81G and G-128T in community-living Japanese.PMID:15723764
the deficiency of CCK-R may be a key point leading to the impairment of gallbladder motor function and the pathogenesis of cholesterol gallstone formationPMID:15786550
possible role of the CCK-AR gene in the vulnerability to schizophrenia in patients with auditory hallucinationsPMID:17413443
No evidence for the association between the CCK-AR gene and schizophrenia in the Japanese population.PMID:17413452
CCK-A receptor agonist, GI181771X, did not reduce body in obese patients, suggesting that CCK-A by itself does not have a central role in long-term energy balance.PMID:17597711
Responses of human esophageal sphincter sling and clasp fibers to cholecystokinin (CCK) and gastrin through CCK-A and -B receptors are reported.PMID:18444993
Report effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation.PMID:18776046