Home
Product
Protein
Transmembrane Proteins
Recombinant Human Chloride intracellular channel protein 3 (CLIC3)

Recombinant Human Chloride intracellular channel protein 3 (CLIC3)

Code: CSB-CF005548HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4260

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

CLIC3

Uniprot NO.

O95833

Alternative Names

CLIC3; Chloride intracellular channel protein 3

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-236

Target Protein Sequence

MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPV PAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKL HIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Can insert into membranes and form chloride ion channels. May participate in cellular growth control.

Gene References into Functions

CLIC3 is also secreted by cancer cells, is abundant in the stromal and tumour compartments of aggressive ovarian cancers and its levels correlate with poor clinical outcome. PMID:28198360
in malignant pleural mesothelioma, the gene expressions of CLIC3 and CLIC4 were significantly increased compared to controls PMID:26445368
CLIC3 controls trafficking of late endosomal MT1-MMP and dictates invasion and metastasis in breast cancer. PMID:25015290
results suggest that increased expression of chloride intracellular channel 3 (CLIC3) may play a role in abnormal placental function associated with the human pregnancy disorders fetal growth restrict and pre-eclampsia PMID:22795578
The structure of the soluble form of CLIC3, is presented. PMID:20146363
CLIC3 facilitates chloride ion movement and regulates cellular processes associated with the movement of chloride in placental and fetal membrane cells. PMID:17027078

Hide All

Subcellular Location

Nucleus. Membrane; Single-pass membrane protein. Cytoplasm.

Protein Families

Chloride channel CLIC family

Tissue Specificity

Detected in placenta (at protein level). Widely expressed. High expression is found in placenta followed by lung and heart. Low expression in skeletal muscle, kidney and pancreas.

Database Links

HGNC: 2064

UNIGENE: Hs.64746

KEGG: hsa:9022

STRING: 9606.ENSP00000419378

OMIM: 606533

Promotions