CLIC1; G6; NCC27; Chloride intracellular channel protein 1; Chloride channel ABP; Nuclear chloride ion channel 27; Regulatory nuclear chloride ion channel protein; hRNCC
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
2-241
Target Protein Sequence
AEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPG GQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNS NPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLL PKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Involved in regulation of the cell cycle.
Gene References into Functions
After CLIC1 knockdown, the expression levels of ITGalpha3, ITGalphav, ITGbeta1 and Bcl-2 mRNA and protein were decreased significantly in gastric cancer cells, as well as AKT-phosphorylation, ERK-phosphorylation and p38-phosphorylation, were reduced in vivo.PMID:29669336
The current study provides the first statistically convincing evidence that downregulation of miR-372 may occur in gallbladder cancer tissues, which may be associated with aggressive and progressive tumor behavior by affecting CLIC1 expression.PMID:28944858
The CLIC1-mediated drug resistance is achieved through positive regulation of MRP1 in choriocarcinoma.CLIC1 is highly expressed in chemoresistant choriocarcinoma.PMID:27983917
Proteomic analysis indicates that CLIC1 promotes tumorgenesis in epithelial ovarian cancer.PMID:27825122
CLIC1 is a possible tumor marker for ovarian cancer. Dendritic cells pulsed with MtHsp70-CLIC1 can enhance antitumor immunity against ovarian cancer, providing a novel immune therapeutic strategy.PMID:29061300
Either dysfunction or downregulation of CLIC1 can partially decrease the antineoplastic effects of metformin.PMID:28378944
The expression of CLIC1 might be closely related to the carcinogenesis, clinical biological behaviors, and prognosis of pancreatic ductal adenocarcinomas.PMID:27461670
Extracellular vesicle-mediated transfer of CLIC1 protein is a novel mechanism for the regulation of glioblastoma growth.PMID:26429879
Results indicate that CLIC1 is an important contributor to tumor invasion, metastasis, and angiogenesis.PMID:25205595
CLIC1 acts as a putative oncogene in pancreatic cancer.PMID:25920608
Data show that glutamate 85 and glutamate 228 are pH-sensor residues of chloride intracellular channel protein CLIC1 and contribute to the pH-response stability in different ways.PMID:25209805
CLIC1 and CLIC4 are overexpressed in specific tumor types or their corresponding stroma and change localization and function from hydrophilic cytosolic to integral transmembrane proteins. (Review)PMID:25546839
CLIC1 may be a potential sensitive and specific molecular biomarker for early diagnose for serous epithelial ovarian cancers metastasis.PMID:25582317
It participates in migration and invasion of hepatocellular carcinoma by targeting maspin.PMID:24989236
The expression of CLIC1 is closely related to the progression of gall bladder cancer and may be used as an effective marker for predicting the prognosis of this disease.PMID:25227665
Data indicate the chloride channel protein CLIC1 as the most penetrant receptor.PMID:24661138
Results indicate that CLIC1 could regulate prostate cancer cell proliferation and migration by regulating the(MAPK)/ERK pathway.PMID:25279971
CLIC1 protein is involved in the metastasis of colon cancer LOVO cells via regulating the ROS/ERK pathway in the hypoxia-reoxygenation processPMID:24587680
Mutation of the two charged amino acids (K37 and R29) in the putative transmembrane region of CLIC1 alters the biophysical properties of the ion channel in both artificial bilayers and cells.PMID:24058583
our results are consistent with a model of CLIC function in which covalent binding of glutathione does not occur spontaneously but requires interaction with another protein to stabilise the GSH binding site and/or transfer of the ligandPMID:24089665
We have identified a cation-pi interaction involving Lys37. Although this residue is not required for folding, membrane binding, or insertion, it does facilitate CLIC1 transmembrane domain self-association.PMID:24328417
In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.PMID:23792823
Reduced gliomagenesis after CLIC1 targeting in tumoral stem/progenitor cells and the finding that CLIC1 expression is inversely associated with patient survival suggest CLIC1 as a potential target and prognostic biomarker.PMID:24115360
increased CLIC1 protein expression is associated with clinicopathological factors and a poor prognosis of hepatic tumors.PMID:23593969
cholesterol dependent behaviour of CLIC1PMID:23457643
the first evidence that CLIC1 expression might play an important role in the regulation of aggressiveness in human gliomasPMID:22578365
High CLIC1 expression can efficiently inhibit proliferation and enhance apoptosis, migration and invasion of gastric cancer cells in vitro.PMID:22791942
knockdown of PA28beta could enhance tumor invasion and metastasis, at least in part, through up-regulation of CLIC1 in gastric adenocarcinomaPMID:22173998
CLIC1 regulates the migration and invasion of colon cancer cells.PMID:22426742
Both histidine (His)74 and His185 are involved in triggering pH changes to the conformational stability of wild-type CLIC1 via their protonation, which stabilizes the intermediate state.PMID:22242893
Intermolecular FRET data suggest that (1) N-terminal domain of CLIC1 inserts into bilayer as extended alpha-helix, (2) CLIC1 forms oligomer upon oxidation in presence of membranes, and (3) CLIC1 inserts into bilayer as oligomer of 6-8 subunits.PMID:22082111
Data show that the expression of HSP27 and CLIC1 was strongly positive in 61 (59.2%) and 49 cases (47.6%), respectively.PMID:21858536
Suppression of CLIC1 contributes to acquisition of the radioresistance phenotype of laryngeal cancer cells via inhibition of reactive oxygen species production.PMID:20461716
Consistent with previous findings, the N-terminal domain of CLIC1 is likely to insert into the lipid bilayer, while the C-domain remains in solution on the extravesicular side of the membranePMID:20507120
statistical analysis of CLIC1 level in plasma shows that CLIC1 could be applied as a marker for early detection of nasopharyngeal carcinomaPMID:19845400
CLIC1 may play a role in the regulation of osteoblastic differentiation from mesenchymal progenitors, although its physiologic role in osteoblasts remains to be determined.PMID:19703605
on oxidation CLIC1 undergoes a reversible transition from a monomeric to a non-covalent dimeric state due to the formation of an intramolecular disulfide bond (Cys-24-Cys-59)PMID:14613939
insulin induces the proteasome-dependent degradation of SRp20 as well as the subnuclear relocalization of CLIC1PMID:15827065
In certain polarized columnar epithelia, CLIC1 may play a role in apical membrane recycling.PMID:17326840
Data showed that CLIC1 and CLIC5, but not CLIC4, were strongly and reversibly inhibited (or inactivated) by F-actin.PMID:18028448
CLIC1 and TPD52 were significantly (P<0.05) up-regulated in all cases of colorectal cancer investigated, irrespective of localization, pTNM stage and grade of colon cancer.PMID:18710659
Acid-induced destabilization and partial unfolding of CLIC1 involve helix alpha1 which is the major structural element of the transmembrane region.PMID:18850721
Overexpression of CLIC1 promoted cell motility & invasion of gallbladder carcinoma cell lines in vitro, while RNA interference of CLIC1 remarkably decreased these. CLIC1 might play an important role in metastasis of gallbladder carcinoma.PMID:19299076
Amyloid-b stimulation of neonatal rat microglia increases CLIC1 protein and functional expression of CLIC1 chloride conductance. Blocking CLIC1 or reducing it by siRNA in amyloid-b treated microglia cocultured with neurons inhibits neurotoxicityPMID:15190104
Soluble E. coli-derived recombinant CLIC1 moves from solution into artificial bilayers and forms chloride-selective ion channels with essentially identical properties to those observed in CLIC1-transfected CHO cells.PMID:11978800
The structure of oxidized CLIC1 has been determined. The oxidized CLIC1 dimer maintains its ability to form chloride ion channels in artificial bilayers and vesicles, whereas a reducing environment prevents the formation of ion channels by CLIC1PMID:14613939
By selectively tagging either N- or C-termini of NCC27 (CLIC1) and varying the side of the membrane from which channel activity is recorded, NCC27 can be seen to be a TM protein forming part of an ion channel.PMID:10834939
NCC27 (CLIC1) is a 27 kDa intracellular ion channel localized to the nucleus and cytoplasm that exists in both a soluble and integral membrane formPMID:9139710
NCC27 (CLIC1) is broadly expressed and highly conserved. NCC27 blockers led to arrest of CHO-K1 cells in the G2/M stage of the cell cycle, the same stage at which this ion channel is selectively expressed on the plasma membranePMID:11195932
The soluble form of CLIC1 has been determined at 1.4-A resolution. The protein is monomeric and structurally homologous to the glutathione S-transferase superfamily, and it has a redox-active site resembling glutaredoxin.PMID:11551966