Recombinant Human Chemokine XC receptor 1 (XCR1)

Code: CSB-CF026188HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4986

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

XCR1

Uniprot NO.

P46094

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-333

Target Protein Sequence

MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for chemokines SCYC1 and SCYC2. Subsequently transduces a signal by increasing the intracellular calcium ions level. Receptor for XCL1/Lymphotactin.

Gene References into Functions

Our study provides the basis for further investigation of the molecular mechanism by which down-regulation of XCR1 promotes the development and progression of HCC. PMID:29408492
Demonstrate equivalence between human and mouse XCR1(+) dendritic cells and human and mouse Langerhans cells. PMID:26966045
results indicate that XCR1 is a new potential therapeutic target for the treatment of lung cancer bone metastasis PMID:26166822
Induction of potent CD8 T cell cytotoxicity by specific targeting of antigen to cross-presenting dendritic cells in vivo via murine or human XCR1. PMID:25520399
XCR1 is expressed early during the course of tumorigenic transformation and contributes towards increased cell migration and proliferation, which can facilitate the prometastatic behavior of epithelial ovarian cancer cells. PMID:22964431
CD8alpha-positive dendritic cells (DCs) and CD103-positive DCs belong to a common DC subset which is unequivocally identified by XCR1 transgene expression despite their different anatomical locations. PMID:21948982
Our findings argue against the hypothesis that genetic variability in the G-Protein-Coupled Receptor Kinase 5 and Casein Kinase 2 genes modifies Parkinson disease susceptibility PMID:21514207
XCR1 expression and biased VH gene usage are distinct features of diffuse large B-cell lymphoma initially manifesting in the bone marrow. PMID:21411777
The expression patterns of XCR1 and XCL1 were conserved in human and mice blood cells, including certain dendritic cell subsets. PMID:20541533
CD141+ dendritic cells are the only cells in human blood that express the chemokine receptor XCR1 and respond to the specific ligand XCL1 by Ca2+ mobilization and potent chemotaxis. PMID:20479115
XCR1 constitutes the first conserved specific marker for cell subsets homologous to mouse CD8alpha+ dendritic cells in higher vertebrates. PMID:20479118
Data show that Kaposi sarcoma-associated herpes virus targets the lymphotactin receptor with both a broad spectrum antagonist vCCL2 and a highly selective and potent agonist vCCL3 PMID:17403668
On the human XCR1, vCCL3 (Kaposi sarcoma- associated herpes virus), mouse XCL1 and XCL1 acted as agonists. PMID:18426556