Recombinant Human Caveolin-1 (CAV1)-VLPs

Code: CSB-MP004571HU(A4)
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
Pls inquire
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CAV1
Uniprot NO.
Alternative Names
CAV
Research Area
Cancer
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-178aa
Target Protein Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation.
Gene References into Functions
  1. using proteomics profiling, we identified a new protein, caveolin-1 that is significantly and consistently augmented in CLL cells after these lymphocytes interact with stromal cell lines. PMID:28971726
  2. Study shows that ITGB1-dependent upregulation of caveolin-1 (CAV1) switches TGFbeta signalling from tumour-suppressive to oncogenic in prostate cancer. work suggests TGFbeta signalling and beta1 integrins as potential therapeutic targets in prostate cancer over-expressing CAV1, and contributes to better understand the paradoxical dual role of TGFbeta in tumour biology. PMID:29402961
  3. results showed that CAV-1 could promote anchorage-independent growth and anoikis resistance in detached SGC-7901 cells, which was associated with the activation of Src-dependent epidermal growth factor receptor-integrin beta signaling as well as the phosphorylation of PI3K/Akt and MEK/ERK signaling pathways PMID:30088837
  4. Cav-1 expression is up-regulated in endothelial cells of atherosclerotic lesions. PMID:29746866
  5. sinonasal inverted papillomas lesions presented increased Caveolin-1 immunopositivity compared to nasal polyposis. Also, smokers presented significantly increased immunopositivity. PMID:30297114
  6. we indicate that weak stromal CAV1 expression in CRLM is an adverse prognostic factor in patients who undergo liver resection for liver-only colorectal metastases. PMID:28515480
  7. Study provides evidence that KIF13B and NPHP4 are both required for establishment of a specialized caveolin-1 membrane microdomain at the ciliary transition zone, which is essential for Shh-induced accumulation of SMO in the primary cilium as well as for activation of GLI-mediated target gene expression. PMID:28134340
  8. High CAV1 expression is associated with gastric cancer cell migration. PMID:30015970
  9. Study shows that progression-related loss of stromal caveolin 1 levels fosters the growth of human PC3 xenografts and mediates radiation resistance. PMID:28112237
  10. Results found decreasing trend of cav-1 (transcripts I and II) in tumoral tissues especially in stages I and II and seem to be associated with the incidence and promotion of breast cancer, especially in the initial stages of breast cancer. PMID:28857238
  11. minor alleles for SNPs rs3779512, rs7804372 and rs1049337 might be associated with a higher risk of hypertriglyceridemia. PMID:29662258
  12. stromal expression of CAV1 in primary tumors was not associated with clinical outcome whereas the stromal expression of especially CAV2 in the metastatic lymph nodes could be associated with lung cancer pathogenesis. PMID:29850392
  13. CAV-1 is important for NAFLD-HCC survival in fatty acid-rich environments and is a potential therapeutic target. PMID:29896915
  14. At the onset of mitotic cell rounding, caveolin-1 is targeted to the retracting cortical region at the proximal end of retraction fibres, where ganglioside GM1-enriched membrane domains with clusters of caveola-like structures are formed in an integrin and RhoA-dependent manner. PMID:27292265
  15. down-regulation of Cav-1 may aggravate DNA damage of Chang liver cells through reducing the interaction of Cav-1 and Mdm2, which results in the promotion of p53 degradation. PMID:29270591
  16. High CAV1 expression is associated with Small Cell Lung Cancer. PMID:29479989
  17. NEDD8 seems to inhibit the Src-mediated phosphorylation of caveolin-1 by modifying the structure of caveolin-1 protein, which blocks the migration of cancer cells. Although the neddylation process is currently regarded as an emerging target for cancer therapy, our results suggest the possibility that the inhibition of neddylation could facilitate cancer invasion or metastasis at least in some types of cancers. PMID:29301501
  18. High CAV1 expression is associated with Aggressive Behaviour of Breast Cancer. PMID:28236153
  19. Cav1 and PY14Cav1 were positively correlated with ESCC lymphatic metastasis and cancer stages. Rho/ROCK pathway activation promoted ESCC metastasis by regulating Cav1. PMID:29288243
  20. we revisited the question of the relationship between Cav1 and Stat3-ptyr705 in non-transformed mouse fibroblasts and in human lung carcinoma cells, by examining their effect at different cell densities.Our results demonstrate that Cav1 downregulates cadherin-11, by a mechanism which requires the Cav1 scaffolding domain. This cadherin-11 downregulation, leads to a reduction in cRac1 and Stat3 activity levels. PMID:29458077
  21. Cav-1 acts as a positive or negative regulator of tumor cell growth via the reciprocal control for the RAF-ERK feedback loop, and the mitogenic switch of Cav-1 function is tightly linked to bidirectional alteration of its expression in tumor progression. PMID:29141593
  22. This is the first demonstration of caveolin-1 expression in human primary uveal melanoma cell lines and observation that the origin of cells (uveal/cutaneous) has an impact when considering the utility of caveolin-I as a melanoma cell marker. PMID:29847075
  23. Together, these results suggest that CAV1 protects host cells against Group A Streptococcus invasion by a caveola-independent mechanism. PMID:28778116
  24. CAV-1 is commonly downregulated in patients with primary CRC, which suggests its tumor suppressor role in early stages of this disease. PMID:28560511
  25. CAV1 protects Hepatocellular carcinoma cells from TGF-beta-induced apoptosis, which attenuates its suppressive effect on clonogenic growth and increases its effects on cell migration. CAV1 has an essential role in switching the response to TGF-beta from cytostatic to tumorigenic, which could have clinical meaning in patient stratification. PMID:29022911
  26. Our finding that Cav1 is both an aggresome-inducing and aggresome-localized protein provides new insights into how cells handle and respond to misfolded Cav1. They also raise the possibility that aggresome formation may contribute to some of reported phenotypes associated with overexpressed and/or mutant forms of Cav1. PMID:27929047
  27. High glucose induced cell senescence in glomerular mesanginal cells is dependent on caveolin-1 signaling. PMID:27048255
  28. caveolin-1 (Cav-1) participates in intraocular pressure maintenance via modulation of aqueous humor drainage from the eye. PMID:27841369
  29. this study confirmed the association of rs4236601 with primary open-angle glaucoma in different Chinese cohorts, and also found a common single-nucleotide polymorphism rs3801994 of diverse associations with primary open-angle glaucoma between Chinese and Japanese PMID:27297022
  30. Purified caveolin 8S oligomers assumed disc-shaped arrangements of sizes that are consistent with the discs occupying the faces in the caveolar polyhedra. Polygonal caveolar membrane profiles were revealed in tomograms of native caveolae inside cells. We propose a model with a regular dodecahedron as structural basis for the caveolae architecture. PMID:27834731
  31. Cav-1 may play a role in the pathogenesis of oral lichen planus and carcinogenesis of squamous cell carcinoma, but its role in malignant transformation of OLP is not confirmed. PMID:28554768
  32. We examined the consequences of a familial pulmonary arterial hypertension -associated frameshift mutation in CAV1, P158PfsX22, on caveolae assembly and function. We conclude that the P158PfsX22 frameshift introduces a gain of function that gives rise to a dominant negative form of CAV1, defining a new mechanism by which disease-associated mutations in CAV1 impair caveolae assembly. PMID:28904206
  33. study identified Cav1 and MTCH2 as the molecular targets of DHA and revealed a new link between the upstream Cav1/MTCH2 upregulation and the downstream activation of the cell death pathway involved in the DHA-mediated inhibition of cell viability. PMID:28498397
  34. Folate deficiency impaired spermatogenesis and reduced sperm concentration may partly due to inhibiting the expression of the three key molecules (Esr1, Cav1 and Elavl1) essential for sperm production. PMID:28445960
  35. Reduced expression of caveolin-1 in monocytes could aggravate the TLR4-mediated inflammatory cascade PMID:27981790
  36. These results suggest that the phosphorylated CAV1 functions to activate autophagy through binding to the BECN1/VPS34 complex under oxidative stress and to protect against ischemic damage. PMID:28542134
  37. Caveolin-1 has a role in promoting Ewing sarcoma metastasis regulating MMP-9 expression through MAPK/ERK pathway PMID:27487136
  38. Stromal, but not tumoural, caveolin-1 expression is significantly associated with survival in Asian women with triple-negative breast cancers. PMID:28735300
  39. High CAV1 expression is associated with lung cancer. PMID:26930711
  40. Kidney transplant patients with high levels of caveolin-1 immunoreactivity in peritubular capillaries (PTCs) had a significantly worse prognosis than patients with lower levels. CAV-1 immunoreactivity in PTCs was independently associated with graft failure. PMID:27543925
  41. CAV-1 knockdown by siRNA causes increased radiosensitivity in basal-like TNBC cells. The mechanisms associated with this effect are reduced DNA repair through delayed CAV-1-associated EGFR nuclear accumulation and induction of G2/M arrest and apoptosis through the combined effects of CAV-1 siRNA and radiation. PMID:29169152
  42. Fluctuation of reactive oxygen species inhibited migration through reducing the interaction between DLC1 and CAV-1. PMID:28130753
  43. We discuss here current knowledge and future approaches to elucidating the molecular mechanisms underlying CAV1 action during hepatocarcinogenesis and evaluate its potential use in clinical therapies. PMID:28741517
  44. Caveolin-1 phosphorylation on tyrosine 14 may have a role in augmenting melanoma metastasis but not tumorigenesis PMID:27259249
  45. These results suggest that Cav-1 may be a predictor of the poor efficacy of EGFR-TKIs treatment in lung adenocarcinoma with EGFR mutations. PMID:29137977
  46. Studied effect of Aliskiren on interleukin-6, endothelial nitric oxide synthase and caveolin-1 in human aortic endothelial cells. Findings suggest that aliskiren reverses the effects of IL-6 on eNOS and caveolin-1 thru increase in eNOS phosphorylation and nitric oxide production, decrease caveolin-1 phosphorylation, and decrease the interaction between eNOS and caveolin-1. PMID:27773804
  47. miR-192 is downregulated in rheumatoid arthritis (RA)synovial tissues and restoration of its expression elicits growth-suppressive effects on RA-FLSs by targeting CAV1. The miR-192/CAV1 pathway may represent a novel target for prevention and treatment of RA. PMID:28321538
  48. At the CAV1 gene polymorphism rs926198, minor allele carriers displayed higher odds of insulin resistance and low high-density lipoprotein. Aldosterone levels correlated with higher homeostatic model assessment of insulin resistance and resistin and lower high-density lipoprotein only in minor allele carriers. PMID:27680666
  49. Our findings highlight the importance of Cav-1 in hematogenous metastasis, and provide new insights into the underlying mechanisms of mechanotransduction induced by low shear stress PMID:26919102
  50. Deregulated expression of miR-107 inhibits metastasis of pancreatic ductal adenocarcinoma through inhibition PI3K/Akt signaling via caveolin-1 and PTEN. PMID:29111166

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Membrane raft. Golgi apparatus, trans-Golgi network. Note=Colocalized with DPP4 in membrane rafts. Potential hairpin-like structure in the membrane. Membrane protein of caveolae.
Protein Families
Caveolin family
Tissue Specificity
Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Expressed in the brain.
Database Links

HGNC: 1527

UNIGENE: Hs.74034

KEGG: hsa:857

STRING: 9606.ENSP00000339191

OMIM: 601047

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products